KEGG   Nitrosococcus watsonii: Nwat_2331Help
Entry
Nwat_2331         CDS       T01266                                 

Definition
aspartate/ornithine carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nwa  Nitrosococcus watsonii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Nwat_2331
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Nwat_2331
Enzymes [BR:nwa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Nwat_2331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2533709..2534791
Genome map
AA seq 360 aa AA seqDB search
MVKKFDPSLRKPLQPKDDTAGIERPLALMEQVPEDPAPLVSLANRPVLSARQFDRDKIIQ
LSRLAALYETTPTWLQLPLAGKILINAFYEPSTRTRLSFESAWHRLGGDVMPITDPATTG
IAKGETLADVAEMFNNYGDLVVLRDSSEEAVYQMLESLRIPIINAGNGIDEHPTQALADL
YTLFKWRPQLMAAKVSASAQIRIGIVGAPRYMRTVRSLLLFLALFAPAIKEVVVICQQEA
VFAKEQREELALSGLTLRTARHLNPELPALDVIYINSIAWRGDSFEKIGEDLRLCRSSPL
KPGAIILHPLARGKELSTDLDNTEHNWYFAQARGAVFMRMALLTSLVQRIDQVMDTPIQS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaaaatttgacccctcattaaggaaacccttacaaccgaaggatgatacggcg
gggattgaacggcccttggctttaatggagcaagtgccagaagatcccgccccactggtg
agcttggctaaccgccccgtgcttagcgcccgccaattcgaccgagataagatcattcaa
ttgagccgcttggcggccctttatgaaaccacccctacctggctacagctccccctagcc
gggaaaatcctcattaatgccttctatgagcccagcacccggacccgcctttcctttgaa
agcgcctggcatcggctaggaggcgatgtgatgcccatcaccgatccggcgaccaccggc
atcgccaagggcgaaaccttagctgatgtggctgaaatgttcaataattacggagacttg
gtcgtactgcgggatagcagcgaagaggccgtctaccaaatgctggagtccttacgcatt
cctatcatcaatgccggtaatggcatcgatgagcatcccactcaagccttagccgatctg
tatacactgtttaaatggcggccgcagcttatggcagctaaggtttccgcctcggcccaa
atacgaataggcatcgtgggcgcaccccgctacatgcgcacagtgcgcagcctgctgttg
ttcctagccctatttgcgccagcaataaaggaggtcgtggttatctgccagcaagaagcc
gtatttgcaaaagagcaacgagaagaactggccctttccggccttacccttcgtaccgcc
cgtcatctcaatccagaacttcctgccttggatgtgatctatatcaattccatcgcttgg
cggggggatagcttcgaaaaaataggggaagacttgcgactttgccgatcctctcccctc
aaaccaggggcgattattctccatcctttagcccggggaaaagaactctccaccgatttg
gataacaccgagcataactggtactttgcccaggcccggggcgccgtctttatgcgcatg
gccctgctcacttccctcgtgcaacgaatcgatcaagtgatggatactcccatacaaagc
taa

DBGET integrated database retrieval system