KEGG   Nitrosococcus watsonii: Nwat_2331Help
Entry
Nwat_2331         CDS       T01266                                 

Definition
aspartate/ornithine carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nwa  Nitrosococcus watsonii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nwa00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nwa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2533709..2534791
Genome map
AA seq 360 aa AA seqDB search
MVKKFDPSLRKPLQPKDDTAGIERPLALMEQVPEDPAPLVSLANRPVLSARQFDRDKIIQ
LSRLAALYETTPTWLQLPLAGKILINAFYEPSTRTRLSFESAWHRLGGDVMPITDPATTG
IAKGETLADVAEMFNNYGDLVVLRDSSEEAVYQMLESLRIPIINAGNGIDEHPTQALADL
YTLFKWRPQLMAAKVSASAQIRIGIVGAPRYMRTVRSLLLFLALFAPAIKEVVVICQQEA
VFAKEQREELALSGLTLRTARHLNPELPALDVIYINSIAWRGDSFEKIGEDLRLCRSSPL
KPGAIILHPLARGKELSTDLDNTEHNWYFAQARGAVFMRMALLTSLVQRIDQVMDTPIQS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaaaatttgacccctcattaaggaaacccttacaaccgaaggatgatacggcg
gggattgaacggcccttggctttaatggagcaagtgccagaagatcccgccccactggtg
agcttggctaaccgccccgtgcttagcgcccgccaattcgaccgagataagatcattcaa
ttgagccgcttggcggccctttatgaaaccacccctacctggctacagctccccctagcc
gggaaaatcctcattaatgccttctatgagcccagcacccggacccgcctttcctttgaa
agcgcctggcatcggctaggaggcgatgtgatgcccatcaccgatccggcgaccaccggc
atcgccaagggcgaaaccttagctgatgtggctgaaatgttcaataattacggagacttg
gtcgtactgcgggatagcagcgaagaggccgtctaccaaatgctggagtccttacgcatt
cctatcatcaatgccggtaatggcatcgatgagcatcccactcaagccttagccgatctg
tatacactgtttaaatggcggccgcagcttatggcagctaaggtttccgcctcggcccaa
atacgaataggcatcgtgggcgcaccccgctacatgcgcacagtgcgcagcctgctgttg
ttcctagccctatttgcgccagcaataaaggaggtcgtggttatctgccagcaagaagcc
gtatttgcaaaagagcaacgagaagaactggccctttccggccttacccttcgtaccgcc
cgtcatctcaatccagaacttcctgccttggatgtgatctatatcaattccatcgcttgg
cggggggatagcttcgaaaaaataggggaagacttgcgactttgccgatcctctcccctc
aaaccaggggcgattattctccatcctttagcccggggaaaagaactctccaccgatttg
gataacaccgagcataactggtactttgcccaggcccggggcgccgtctttatgcgcatg
gccctgctcacttccctcgtgcaacgaatcgatcaagtgatggatactcccatacaaagc
taa

DBGET integrated database retrieval system