KEGG   Nitrosococcus watsonii: Nwat_2332Help
Entry
Nwat_2332         CDS       T01266                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nwa  Nitrosococcus watsonii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nwa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2534927..2536939
Genome map
AA seq 670 aa AA seqDB search
MCGIAGYIHLNPSRPIDPQTLVAMAAIQHHRGPDGFGYQLIDKQGVGFSHARLSIIDLEA
NRGRQPFTSEDGRLLLTTNGEFYDYKRLRADSISRGARFRTKSDSELVLHLYPRLGLRGM
LPHLRGEFAFALYDQERDRLMLIRDRFGIKPLYWTQVNDTLVFGSEIKALFAHPEVPRCF
SPQGLFHQLMQTMVPGSTAFEGIQQVKPGHVVMVERKQGNFQIREEKYWDLDFPRLSERS
DSLPEEHHIEGVRAQLTEAVQLRLEADVPVGCYLSGGIDSCIALGLSAAIQQAPVKAFTI
GFDDVDYDETPIAQEMARATGADQDIIHLKADHLYDHFAETLWHTERTIYNTLGVAKLLM
SRHVHQTQYKVVVTGEGSDELFGGYPSFRRDMILHGLETLSAQERVQWERGLAESNQLFR
GAMLAENETHNPALDALVGFTPSCLQPWLHAAEHVPALLSVPLREQVESYDPGQAIAEHL
DGDMLANRHPLDKAQYVWIKTMLEGQILTWGGDRVDMANSMEARPPFLDHHLAEFATGLP
PAMRIKGQKEKYVLREAMRGLLPNVLYEREKFAFMAPPAHTDPKKWAAMNQLAQKYLTEE
AITHTGLLDAQGVKALFALHEAEGTPLSTKVRLDAVINHLLGVQILHQHFIATDIPALAR
QRAQELGWHI
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattgctggctacattcatctaaaccctagccgccctatcgacccccaaacc
ctcgtggccatggccgccatccaacatcatcgtggtcctgatggcttcggttatcaactc
atcgacaagcaaggggtcggcttcagccacgcccgcctctccattatcgacctggaagca
aaccggggccggcagccttttacctccgaagatggccggctgctacttaccactaatggg
gaattttatgactacaagcgattgcgggccgattccatctcccgtggcgcccgctttcgc
actaaaagcgactcagagttagtactccatctctacccccggctggggctgcgagggatg
ttgcctcacttacggggagaattcgcctttgccctttatgatcaagaaagggatcggtta
atgctgatccgagaccgcttcggtatcaaacccctctactggacccaggtcaatgacacc
ctggtatttggctccgaaatcaaggccctgtttgcccaccctgaagtgccacgctgcttc
agcccccagggcctgtttcatcagctcatgcaaaccatggtgccaggcagcaccgccttc
gagggcattcagcaagtcaaaccgggacatgtagtcatggtggaacgcaagcagggtaat
ttccaaatccgggaagagaaatactgggatttggattttccccggctctcggaacgctcc
gactccctccctgaagaacaccatattgaaggagtccgggctcagcttaccgaggcggta
caacttcggctagaagcggatgtcccggtgggctgttatctctccggcggtatcgactcc
tgcattgccttgggcctctcggctgctatccaacaagcgccggtcaaagcctttactatc
ggctttgatgatgtggactacgatgaaacccccatcgcccaagaaatggcgcgagccaca
ggagctgatcaagatatcatccatcttaaggctgatcacctctatgaccacttcgctgaa
accctctggcacacggaacgaaccatctataacactctcggtgtcgctaaactgctcatg
agtcgtcatgtccaccaaacccaatacaaagtcgtggtgactggggagggctcggatgaa
ttattcggcggctacccctctttccgccgggatatgattctccatgggctggaaactctc
tctgcccaggagcgggtccagtgggagcggggtttagccgagagtaaccaacttttccgg
ggagccatgctagccgagaacgagacccataatcctgccctggacgccctagtaggcttc
acaccaagttgtctgcaaccttggctccacgcggcggaacatgtccccgccttgttgagt
gtcccgctccgggagcaagttgaaagctatgacccaggccaggctattgccgagcatttg
gacggggatatgctggccaaccggcaccccctggataaggcccagtatgtctggataaaa
accatgctggaggggcaaatcttgacctggggaggcgatcgggtggatatggccaattcc
atggaagcccgccccccctttctggaccatcacctggccgaatttgccacgggactgccc
cccgccatgcggatcaaggggcaaaaggagaaatatgtgctacgggaagctatgcgggga
ctcctgcccaacgtgctttatgaacgggaaaagtttgccttcatggcgccacccgcccat
accgatcctaaaaaatgggcggccatgaaccaactagctcaaaaatacctgaccgaggag
gccattacccatactggattactggacgcgcaaggggttaaggctctgtttgccttgcat
gaagctgaagggacgcccttatcgactaaagtccggctagatgcggttatcaaccatctt
ttgggggtgcaaatcctgcatcagcattttatcgccactgatatcccggcgctggctcgg
cagcgggcgcaggagttgggctggcatatttaa

DBGET integrated database retrieval system