KEGG   Nitrosococcus watsonii: Nwat_2334Help
Entry
Nwat_2334         CDS       T01266                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00521  Streptomycin biosynthesis
nwa00523  Polyketide sugar unit biosynthesis
nwa01130  Biosynthesis of antibiotics
Module
nwa_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Nwat_2334
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nwat_2334
Enzymes [BR:nwa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Nwat_2334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom DUF448 DUF2192
Motif
Other DBs
NCBI-ProteinID: ADJ29162
JGI: Nwat_2334
UniProt: D8K8P2
Position
complement(2537950..2538495)
Genome map
AA seq 181 aa AA seqDB search
MKATSTPLPGVLLIEPRVFGDERGFFFESYNRVAFAAATDIQAEFVQDNHSYSAKHVLRG
LHYQIHQPQGKLVRVIAGEVFDVAVDLRRHSPGFGRWVGYRLSAENRRQLWIPGGFAHGF
LVLSEYAEFLYKTTAYYAPEYERCIRWDDPDLAIDWPLEEVPLISAKDQAGCAFKEAELL
P
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaacctcaacaccgctccccggcgttttgttgatcgaaccccgtgtctttggc
gatgaacggggatttttctttgaaagctataatcgggttgcctttgcggcggcaaccgat
atccaggccgagtttgtgcaggataaccattcctattcggccaagcatgttctgcgggga
ttacactaccaaattcaccagccccaagggaagttagttcgggtaattgctggtgaagtt
tttgacgtggccgttgatctgcggcgccattctcctggctttggccgctgggtgggttac
cgtctctcggcggaaaacaggcgccagctttggataccaggagggtttgctcacggtttt
ttggtgttaagcgagtatgcggaatttttatataaaactaccgcctactatgcgccggag
tatgagcgctgcattcgctgggatgatcccgatctggccattgattggcctttggaggag
gtgccgctcatttccgccaaggatcaagctggttgtgcttttaaggaggcggagctattg
ccgtga

DBGET integrated database retrieval system