KEGG   Nitrosococcus watsonii: Nwat_2399Help
Entry
Nwat_2399         CDS       T01266                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00020  Citrate cycle (TCA cycle)
nwa00640  Propanoate metabolism
nwa00660  C5-Branched dibasic acid metabolism
nwa01100  Metabolic pathways
nwa01110  Biosynthesis of secondary metabolites
nwa01120  Microbial metabolism in diverse environments
nwa01130  Biosynthesis of antibiotics
nwa01200  Carbon metabolism
Module
nwa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nwa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nwat_2399
   00640 Propanoate metabolism
    Nwat_2399
   00660 C5-Branched dibasic acid metabolism
    Nwat_2399
Enzymes [BR:nwa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Nwat_2399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ADJ29221
JGI: Nwat_2399
UniProt: D8K978
Position
complement(2611187..2612356)
Genome map
AA seq 389 aa AA seqDB search
MILHEFQAKCLFSDYGIPVPSGGPARSAEEACAWARKLGGERWVIKAQVHAGGRGKAGGV
RVVASMEELSDFCSHLLGTRLVTAQTDATGLPVQNLLVEQPAAIAREFYLAATLDRQLER
VVIMASSRGGVNIEQVAATYPGEILQLAIHPVVGLQSYQCRRVGFAFGLTSEQHRQLVQI
MEKMYRLFLEQDASLVEMNPLVVTEQGDLLALDAKVVLDDNAAFRHATWEALRDPTQENQ
KEVEARTHGLSYIALEGDIACMVNGAGLAMATMDLIKLQHGEPANFLDVGGTATAERVTE
AFKLILTDTKVKSILVNIFGGIVRCDLIAEGIIQAVQEVEIQLPVVVRLEGTNAKQGRAL
LRESGMKLITADDLTDAARKAVAAAGERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgattttgcatgaatttcaggctaaatgcctgttctcggattatggaatccctgttcct
tccggaggtcctgccaggtctgcggaggaagcttgcgcatgggcgcggaagttagggggg
gagcgctgggtaatcaaggcccaggtgcatgctggtgggcgcggcaaggccggtggggtg
cgggtagttgccagtatggaggaactatcggacttttgctcccacttgttggggacccgt
ttagtgacggcgcaaaccgatgccacggggttaccggtgcaaaacctcttggtggagcag
ccagcggcgatagctcgggaattttatcttgctgcaaccctggaccgccagttggaacgg
gtggtgatcatggcttcaagccgtggcggggtaaatattgagcaggtagcagcaacgtat
cccggcgaaattctccaattggcaatccatcccgtagtaggattacagtcttatcagtgt
cggcgggtaggcttcgcttttggattgacttcggaacagcaccggcaactcgtccagatt
atggaaaaaatgtaccgcttatttttggagcaagatgcaagcttggtggagatgaaccca
ttagtggtaacggagcagggcgatttgctcgctttggatgccaaggtggtactggatgat
aatgccgctttccggcacgctacttgggaggcgttacgcgaccctacccaagaaaatcag
aaagaagttgaggcccggactcatggtttaagctacattgccttggaaggggatattgcc
tgtatggttaatggggcgggtctggccatggcgaccatggatctaataaagctccagcat
ggggagccagctaatttcctcgatgtggggggaacagcgacggctgaacgggtgaccgaa
gcttttaagttgatccttaccgatactaaggtgaagtcgattctggtcaatatttttggc
ggtatcgttcgctgtgatctgattgcggaagggattattcaggcagtgcaagaggtagag
attcagttaccggtcgtggtgcgtttggaaggtacgaatgccaaacagggccgtgcccta
ttgcgggagagcggaatgaagctaatcacggcggatgatttgacggatgccgcacgcaaa
gcggttgccgcggcgggggagcgggcatga

DBGET integrated database retrieval system