KEGG   Nitrosococcus watsonii: Nwat_2577Help
Entry
Nwat_2577         CDS       T01266                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nwa  Nitrosococcus watsonii
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Nwat_2577
Enzymes [BR:nwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Nwat_2577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2758457..2759299)
Genome map
AA seq 280 aa AA seqDB search
MLLWPAPAKLNLFLHITGRREDGYHLLQTAFQFIDYCDWLGFRPGADGRIEHLSPLPAVP
VEQDLVYRAALLLQQRTACSQGVEVRIRKHLPMGGGLGGGSSDAATTLVALNHLWGTGLS
ISQLAQLGLELGADVPVFIYGRAAWAEGVGEQLQPLELPEPWYLIVTPAVHVSTREVFTA
PELTRDCKPMTIPGLLAGEGENVCEPVVRGRYPVVAEALDWLSQFSPARMTGTGSSVFAA
FDGKSQALAALACMPSHWQGIVAKGCNDSLLLDCLEKTGC
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgttgctttggcctgctcccgccaaactaaatttgtttctccatatcactggacgccgt
gaagatggttatcatctgctccaaaccgcttttcaatttattgattattgcgattggttg
ggattccggcctggtgcagacgggcgtattgagcacttatcacccttaccggcggtgccg
gtggaacaagacttggtgtatcgagcggctttgctcttgcagcagaggacggcttgctcc
cagggagtagaagtccgaattcgtaagcacctccccatgggtggcggtctaggtggtgga
agctcggatgcggcgactaccttagtggcgttgaatcatctttggggaacagggttatcc
atctcccaactggcccaattgggactggaattgggcgcggacgtgcctgtatttatctat
ggccgcgccgcctgggcagaaggggtgggagagcaattgcagccgcttgagttgcccgaa
ccctggtatttgattgttactccagcggttcacgtatccacccgtgaggtatttaccgct
ccagaattgacacgggattgcaaacctatgacaataccgggtcttcttgccggtgaaggg
gaaaatgtgtgcgagcctgtggtgcgggggcgctatcccgtggtggctgaagcccttgat
tggttgtcccagttttcaccggctaggatgacaggtacgggtagcagtgtattcgcggcg
tttgatggaaaatctcaagccttggcggcattagcatgtatgccttcccattggcaaggt
attgttgctaaaggctgtaatgattcgttattgttagactgtttagagaaaacaggctgt
taa

DBGET integrated database retrieval system