KEGG   Nitrosococcus watsonii: Nwat_2587Help
Entry
Nwat_2587         CDS       T01266                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00860  Porphyrin and chlorophyll metabolism
nwa01100  Metabolic pathways
nwa01110  Biosynthesis of secondary metabolites
nwa01120  Microbial metabolism in diverse environments
Module
nwa_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Nwat_2587
Enzymes [BR:nwa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Nwat_2587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ADJ29369
JGI: Nwat_2587
UniProt: D8KA11
Position
complement(2769494..2770291)
Genome map
AA seq 265 aa AA seqDB search
MAESGIISQQRLAGRRVLVTRPAEQAEKLSLAIELEGGQAVRFPTVEIGDSEVPAVVEEI
IGRLDDFHWAVFVSANAVQRGVPWVLCRREMPANLKIAVVGRATAQALEDFGLPPHLCPS
SGYNSEALLAMDELQAMKGQQVVLFRASGGRELLAKTLAKRGAQVEYAEVYRRCLPSPSV
AANLRQALTNVPVDVVITTSKAILENLCHLAGETLLKELRRIPLVVIGSRQAQQARELGF
TQIWVAQEPSDAALVQTIIEHEDKL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaagcgggatcatctcccagcagcggcttgcgggtcgacgggtgttggttacc
cgaccggcagagcaggccgaaaaattatctctagcgattgaacttgaaggcgggcaagcc
gtacgttttccgacggtagaaatcggcgattcggaagtacctgccgtagtagaggaaatt
attggccgtttggatgattttcactgggctgtgttcgtcagcgctaatgcggtgcagcgc
ggagtaccttgggtgctttgtcgccgcgagatgcctgcaaatctcaaaatcgcggtagta
gggcgagccacggcgcaagcgttagaagactttgggctgcctcctcatctttgccctagt
tccggctataacagcgaggcgttgttggccatggatgaattgcaagctatgaaggggcag
caggtcgtcctttttcgggctagtggaggaagggaattgctagcaaagacgttggccaag
cgtggagctcaagtcgaatatgctgaagtataccgccgctgtcttccttccccttccgtg
gccgctaatcttcggcaagccctgaccaatgttccggtagacgtggtgatcaccaccagt
aaagctattttggaaaatctctgccaccttgccggggagactctgctaaaagaacttcgt
agaatcccgctggtggtcatcggttcccggcaagcccagcaagcaagagagcttggattt
acccagatatgggtggcgcaggagcctagcgatgccgctctcgtccagaccattattgaa
catgaggataaattatga

DBGET integrated database retrieval system