KEGG   Nitrosococcus watsonii: Nwat_2672Help
Entry
Nwat_2672         CDS       T01266                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
nwa  Nitrosococcus watsonii
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Nwat_2672
Enzymes [BR:nwa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Nwat_2672
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Nwat_2672
Lipid biosynthesis proteins [BR:nwa01004]
 Fatty acid synthase
  Component type
   Nwat_2672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2845603..2846211)
Genome map
AA seq 202 aa AA seqDB search
MGLLLQPIVPGAAAQPAIVILGDSLSASYGLSLEQGWVARLQERLLRKGYPYQVVNASIS
GETTRGALGRLDSLLAAHQPEIVVIELGGNDGLRGLSLAEIRQNFARIIEKSQQNGAQVL
LVKMRLPPNYGPLYTERFEQLFTDLKDEYGVTIAPFILRGIATQAELMQADGIHPRAEAQ
TLMLDNIWPALASLLATDKAGK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgggtttactgcttcagcccatcgtcccaggagctgcggctcaacccgccattgtcatt
ctgggagacagtcttagcgccagctatggtctttccctggagcaaggctgggtggcccgt
cttcaggaacgattactacgtaaaggctacccttatcaggtggtgaatgccagtattagc
ggcgaaaccacccggggggcgcttggccgcctggattccctgctggccgcccatcagccg
gaaattgtggtgattgaactgggaggcaatgatggcttgcgtggcttgtccctggcggaa
atacgccaaaattttgcccggattattgaaaaatcccagcaaaacggcgctcaggtgctg
ctcgttaaaatgcgtctgccgcctaattacggacctttatataccgagcgttttgagcag
ttatttaccgatctgaaagatgaatacggggtaacaatcgcgcctttcatcctccggggg
atcgccactcaggcggagttaatgcaagcggatggtattcatccccgcgccgaggcccag
acgttaatgctagataatatctggccggcattagcgtccttactagcaacggataaggct
ggaaaataa

DBGET integrated database retrieval system