KEGG   Nitrosococcus watsonii: Nwat_2672Help
Entry
Nwat_2672         CDS       T01266                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
nwa  Nitrosococcus watsonii
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:nwa01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2845603..2846211)
Genome map
AA seq 202 aa AA seqDB search
MGLLLQPIVPGAAAQPAIVILGDSLSASYGLSLEQGWVARLQERLLRKGYPYQVVNASIS
GETTRGALGRLDSLLAAHQPEIVVIELGGNDGLRGLSLAEIRQNFARIIEKSQQNGAQVL
LVKMRLPPNYGPLYTERFEQLFTDLKDEYGVTIAPFILRGIATQAELMQADGIHPRAEAQ
TLMLDNIWPALASLLATDKAGK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgggtttactgcttcagcccatcgtcccaggagctgcggctcaacccgccattgtcatt
ctgggagacagtcttagcgccagctatggtctttccctggagcaaggctgggtggcccgt
cttcaggaacgattactacgtaaaggctacccttatcaggtggtgaatgccagtattagc
ggcgaaaccacccggggggcgcttggccgcctggattccctgctggccgcccatcagccg
gaaattgtggtgattgaactgggaggcaatgatggcttgcgtggcttgtccctggcggaa
atacgccaaaattttgcccggattattgaaaaatcccagcaaaacggcgctcaggtgctg
ctcgttaaaatgcgtctgccgcctaattacggacctttatataccgagcgttttgagcag
ttatttaccgatctgaaagatgaatacggggtaacaatcgcgcctttcatcctccggggg
atcgccactcaggcggagttaatgcaagcggatggtattcatccccgcgccgaggcccag
acgttaatgctagataatatctggccggcattagcgtccttactagcaacggataaggct
ggaaaataa

DBGET integrated database retrieval system