KEGG   Nitrosococcus watsonii: Nwat_2738Help
Entry
Nwat_2738         CDS       T01266                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nwa  Nitrosococcus watsonii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Nwat_2738
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Nwat_2738
Enzymes [BR:nwa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Nwat_2738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2905984..2906958
Genome map
AA seq 324 aa AA seqDB search
MSNLQLDQKGQLRHFLSIQGLNRELLTRILDTAESFSSIGAQQVKKVPLLRGKTIVNLFF
ESSTRTLSTFELAAKRLSADVMNLNVRTSSTQKGESLLDTLRSLEAMHCDMFVVRHSDSG
AAYFIARHVPSHVSVINAGDGCHSHPSQAMLDMFTIRRHKGSFPNLRVAIIGDILHSRVA
RSEIHALATLGTGEIRVIAPRTLLPRNVDSLGVHIFHDMRVGLKGVDVVIMLRLQRERME
GARLPSEREYFQLYGLTEEKLALAQPEAIVMHPGPINRGIEIESAVADGPRSVILEQISH
GIAIRMAVMAMTMQIPVPETKEVR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacctgcaactggatcagaaaggccaattacgccatttccttagcatccagggg
ttaaaccgggagttactgacccgaattttggatacagccgagtctttttccagcatcggc
gcccagcaggtaaaaaaggtccccctattgcggggaaaaaccattgtcaatctctttttt
gaaagcagtacccgaaccttaagcaccttcgagctggccgctaaacgtctatcggcggat
gttatgaatttgaatgtacgcacctcctcgacccagaaaggggaaagtctactggacacc
ctccgcagcctggaggccatgcattgcgacatgttcgtggtccgccactctgatagcggc
gccgcctactttattgctcgtcatgttccttcccatgtcagcgtcatcaacgccggggat
ggctgccattcccacccttcccaggccatgctggatatgtttactatccgccgccacaag
ggctcgtttcccaatctgcgggtagcaatcatcggcgatatcctccactctcgggtagcc
cgctccgaaattcatgccttggcgaccttgggcacgggagaaatccgggtgattgccccc
cgaacactgctgccgcgcaacgtggactcattaggcgttcacatctttcatgatatgcgg
gtgggacttaaaggggtggatgtggtgatcatgctgcggctccaacgggaacgcatggaa
ggggcacggctacccagtgagcgggaatattttcagctctatggcttaaccgaagaaaaa
ctcgccctggcccaaccagaggctatcgtgatgcatccagggcctattaaccgcggtata
gaaatcgaatcggctgtggccgatggtccccgctcggtcatcctggagcagatcagccat
ggtattgccattcgcatggcggtcatggccatgaccatgcagataccagtccctgaaacc
aaggaggttcgctag

DBGET integrated database retrieval system