KEGG   Nitrosococcus watsonii: Nwat_2785Help
Entry
Nwat_2785         CDS       T01266                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nwa  Nitrosococcus watsonii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Nwat_2785
Enzymes [BR:nwa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Nwat_2785
Exosome [BR:nwa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nwat_2785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2957776..2959281
Genome map
AA seq 501 aa AA seqDB search
MTANYILSIDAGTTGITGLIFNREGHIQGRAYSEFTQHYPQPGWVEHDPNEIWSITQKVI
ATALQEAHLETRHLAAIGITNQRETVVMWERSTGEPVAKAIVWQDRRTAPLCEELKARGL
EETFRHKTGLVIDPYFSGTKVRWLLDRVKGLRQQAEAGKIAFGTLDSWLVWKLTGGKIHI
TDYSNASRTLLYNIHDLQWDEEILHILHIPPSLLPEVKPSAHIYGETTPRAFLSTGGIPI
AGIAGDQQAALFGQACHQKGLAKNTYGTGSFVLMNTGKEPNLNQEKLLTSIAWGIGKEPV
EYALEGAIFITGAGIQWLRDGLGIIDDATETEALARSLKSNEEVYFVPALVGLGAPHWDP
YARGTLLGITRGTTKAHLVRAMLESMGYQTRDVVEAMERDSGIALKVLRCDGGASINSFL
MQFQADILGVPVEVPKITETTALGAAYLAGLATGFWRSRKELASQWQLAHRYEPTMPESE
HTRLYQQWQRAVERAKGWSQE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaaattatatattgtccattgatgccggcactaccggcattacgggtttgatt
tttaaccgggaaggtcatattcagggtcgggcctattcagaatttacccagcattaccct
cagccaggatgggtagaacatgatcccaacgaaatttggtcaatcacccaaaaggtaatt
gccaccgccttgcaggaagctcatctggaaacacgccatctagcggccattggcattaca
aaccagcgggaaacggtggtgatgtgggagcgaagtacgggagaacccgtagcaaaagcc
atcgtctggcaagataggcgtaccgcgccgctctgcgaagaactcaaagcgaggggtcta
gaagagacctttcggcacaaaacagggcttgtcatcgatccctatttctccggcactaaa
gttagatggctcctcgaccgggtaaagggacttagacaacaagcagaagccggtaaaatc
gcctttggcactcttgattcctggcttgtctggaagctcaccgggggtaaaattcatatt
accgattactccaatgccagccggacactgctctataacatccacgacctgcaatgggat
gaggaaatcttgcacatactccatatccctccctccctcttgcctgaagttaaaccctct
gcccatatctatggagaaaccacgccccgagcctttctcagcaccggcggtattcctatt
gctggaatcgcgggagatcagcaagccgctcttttcggtcaggcgtgccaccaaaaaggg
ctagccaaaaatacctatggaacaggctccttcgtcctgatgaatacaggaaaggagcct
aacttaaatcaggaaaagcttctgaccagcatcgcctgggggatcggcaaagagcctgtg
gaatatgccctggaaggcgctatttttatcacgggagcaggcattcaatggttgcgggat
ggcctggggatcattgatgatgccacggaaacagaagccctggcccgctccctgaaatcc
aacgaggaagtttattttgtaccggcccttgtgggcttgggtgctccccattgggacccc
tatgcccgcggcaccctgctgggaattacccgtggcacgactaaagcccatctggtacgg
gccatgctagaaagcatgggctaccaaacccgggatgtggtcgaggccatggagcgggat
tcaggcattgcattaaaagtactgcgctgtgatgggggcgcctcgatcaattcctttttg
atgcaatttcaggcggatatcctcggcgtgccggtagaggtaccgaagatcaccgaaacc
actgccttgggcgcagcgtacttggcgggactggccacgggtttctggcgcagccgcaag
gagttggcttcccaatggcaacttgcccaccgctatgagccaaccatgcccgaatctgaa
cacacccgcttatatcagcaatggcaaagggccgtggagcgggctaaaggttggagccaa
gaataa

DBGET integrated database retrieval system