KEGG   Nitrosococcus watsonii: Nwat_2808Help
Entry
Nwat_2808         CDS       T01266                                 

Definition
(GenBank) Phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
nwa  Nitrosococcus watsonii
Pathway
nwa00030  Pentose phosphate pathway
nwa00710  Carbon fixation in photosynthetic organisms
nwa01100  Metabolic pathways
nwa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Nwat_2808
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nwat_2808
Enzymes [BR:nwa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Nwat_2808
    4.1.2.22  fructose-6-phosphate phosphoketolase
     Nwat_2808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ADJ29566
JGI: Nwat_2808
UniProt: D8KBB9
Position
2984880..2987297
Genome map
AA seq 805 aa AA seqDB search
MAQRPQTEHAKRRIEEASPLAADELRNIDAYWRAANYLSVGQIYLQDNPLLTEPLTLEHV
KARLLGHWGTTPGLNFIYAHLNRVIKAHDLNMIYVTGPGHGAPGLVANTWLEGSYTEVYP
NVPQNAAGMQRLFKQFSFPGGIPSHVAPETPGSINEGGELGYALAHAYGAVFDNPDLIAA
CVVGDGEAETGPLATAWHSNKFLNPACDGAVLPILHLNGYKIANPTVLARISREDLKNLL
VGYGYHPYVVEGDKPEQMHPLMAATLDQVVAEIQTIQHAARSQGATPCTRWPMIVLRTPK
GWTGPKEVDGKKTEGYWRSHQVPLAQLADKPEHLRLLEEWMKSYRPEELFDGQGTLRPEL
AALAPQGERRMGANPHANGGLLLKDLRLPEFRDYAISITGPGAELAEATRVMGGYLRDVM
KLNMDNRNFRVMGPDETSSNRLDALFEVTDRTWMAKTLPEDEHLAPDGRVMEILSEHTCQ
GWLEGYLLTGRHGLFSCYEAFIHIVDSMFNQHAKWLKVTGKEIPWRRPIASLNYLLTSHV
WRQDHNGFSHQDPGFIDHVVNKKADVIRVYLPPDANTLLCVTDHCLRSRNFINVIVAGKQ
FQPQWLAMDAAVKHCAAGIGIWRWASNDQGSEPDVVMACAGDVPTLETLAAVDILRHHLP
ELKVRVINVVDLMTLQDKEEHPHGLSHKDFDTLFTTNKPIIFAYHGYPWLIHRLTYRRTN
HKNLHVRGYKEEGTTTTPFDMVVLNDMDRFDLVADVIDRVPKLGSTAAYLKQWLRDKHIE
HKQYITQHGVDMPEVTQWQWGKSGG
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaagaccgcaaaccgagcacgccaagcgcaggatcgaggaggcgagtccgctg
gcagcggacgagctgcgcaacatagacgcctactggcgggcggctaactatctgtcagta
ggtcagatctacctgcaggacaatccgttgcttaccgagccgctcacactggaacacgtt
aaggcacggctgctcggccactggggaaccacgccgggattgaattttatctacgcccac
ttgaaccgcgtgatcaaggcccacgatctcaatatgatctatgtgacgggaccaggccac
ggtgctccggggctggtcgctaacacctggctagagggcagttacactgaagtctatcca
aatgttccccagaacgcggcgggcatgcagcggctattcaagcagttctccttcccgggc
ggcataccaagtcacgtcgccccggaaacgccaggttcaattaacgaaggcggcgaactc
ggctatgccttagcccatgcctacggcgcagtgtttgataacccggacctgatcgccgcc
tgtgtagtgggcgatggcgaggccgagaccggccccctcgccacggcctggcattccaac
aaatttctcaaccctgcgtgcgacggcgcggtactgccgatcctccatctgaacggctac
aaaatcgccaaccctaccgtgctggcgcgcatcagccgtgaggatttaaaaaacctgctt
gttggctacggctatcacccctatgtggtggaaggtgataaaccggagcaaatgcacccg
ctgatggcggctactctcgaccaggtagtggccgaaattcaaacgattcaacacgctgcg
cgcagccaaggcgctaccccctgcacacgctggccaatgatcgttctgcggaccccgaag
ggctggaccggccccaaggaagtcgacggtaaaaaaaccgagggctactggcgctcacac
caggtaccgttggcccaactggctgacaaaccggaacacctgcggctactagaagaatgg
atgaagagctaccgtcccgaggaattgttcgacggacaaggtaccctgcggccagaactg
gcggcgctagcaccccagggcgagcggcgcatgggcgccaacccacacgctaacggcggg
ctgttactcaaggatctgcggttacccgagttccgcgattatgccattagcataaccggt
cccggcgcggagctggcggaggcaactcgagtcatgggcggctatttacgcgacgtgatg
aagctgaacatggataaccgaaatttccgcgtaatgggaccggacgagaccagttccaac
cgcctcgatgccttgttcgaagtgactgatcgtacctggatggcaaaaacactgccagag
gacgagcaccttgcgccggatggccgagtgatggagatcctctccgaacacacctgccag
ggctggctagaaggctatctgctcaccggccgacacggcctattttcctgctacgaagcc
ttcattcacattgtcgattccatgttcaaccagcatgccaaatggcttaaagtcaccggc
aaggaaattccttggcgccgccccatcgcctcgctcaactatctcctaacttcccatgtg
tggcgccaagaccacaacggtttttcacatcaagatcccggcttcatcgatcacgtcgtg
aacaagaaggcggatgtgatccgagtttatctaccgccggacgccaatacactcctatgc
gtcaccgaccactgcctgcgttcgcgcaactttattaacgtcatcgtcgccggtaagcag
ttccagccccagtggctcgccatggatgcggccgtcaagcactgcgccgcaggcatcggc
atctggcggtgggccagcaatgaccagggcagcgaaccagacgtagtgatggcctgtgct
ggtgacgtgccaaccctggagaccttagcggcagtggatattctacgccatcatctgccc
gaacttaaagtgcgggttatcaacgtggtggatctcatgaccctgcaggacaaagaggag
catccccatgggctctcgcacaaggacttcgatacgctttttactaccaataaacccatc
atctttgcctaccatggttatccttggttgattcatcgcctcacctaccggcgcactaat
cacaagaatctacacgtacgcggttacaaggaagagggaacgaccaccaccccctttgac
atggtcgtccttaacgatatggatcggtttgacctggtagcggatgtcatcgatcgcgtg
cctaagctaggatcaacggcagcctatctcaaacaatggctccgggacaaacatatcgaa
cataagcaatacatcacccagcacggggtggatatgccagaggtgacgcaatggcaatgg
ggcaagagcggcggttga

DBGET integrated database retrieval system