KEGG   Nitrosococcus watsonii: Nwat_2808Help
Entry
Nwat_2808         CDS       T01266                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
nwa  Nitrosococcus watsonii
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Nwat_2808
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nwat_2808
Enzymes [BR:nwa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Nwat_2808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2984880..2987297
Genome map
AA seq 805 aa AA seqDB search
MAQRPQTEHAKRRIEEASPLAADELRNIDAYWRAANYLSVGQIYLQDNPLLTEPLTLEHV
KARLLGHWGTTPGLNFIYAHLNRVIKAHDLNMIYVTGPGHGAPGLVANTWLEGSYTEVYP
NVPQNAAGMQRLFKQFSFPGGIPSHVAPETPGSINEGGELGYALAHAYGAVFDNPDLIAA
CVVGDGEAETGPLATAWHSNKFLNPACDGAVLPILHLNGYKIANPTVLARISREDLKNLL
VGYGYHPYVVEGDKPEQMHPLMAATLDQVVAEIQTIQHAARSQGATPCTRWPMIVLRTPK
GWTGPKEVDGKKTEGYWRSHQVPLAQLADKPEHLRLLEEWMKSYRPEELFDGQGTLRPEL
AALAPQGERRMGANPHANGGLLLKDLRLPEFRDYAISITGPGAELAEATRVMGGYLRDVM
KLNMDNRNFRVMGPDETSSNRLDALFEVTDRTWMAKTLPEDEHLAPDGRVMEILSEHTCQ
GWLEGYLLTGRHGLFSCYEAFIHIVDSMFNQHAKWLKVTGKEIPWRRPIASLNYLLTSHV
WRQDHNGFSHQDPGFIDHVVNKKADVIRVYLPPDANTLLCVTDHCLRSRNFINVIVAGKQ
FQPQWLAMDAAVKHCAAGIGIWRWASNDQGSEPDVVMACAGDVPTLETLAAVDILRHHLP
ELKVRVINVVDLMTLQDKEEHPHGLSHKDFDTLFTTNKPIIFAYHGYPWLIHRLTYRRTN
HKNLHVRGYKEEGTTTTPFDMVVLNDMDRFDLVADVIDRVPKLGSTAAYLKQWLRDKHIE
HKQYITQHGVDMPEVTQWQWGKSGG
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaagaccgcaaaccgagcacgccaagcgcaggatcgaggaggcgagtccgctg
gcagcggacgagctgcgcaacatagacgcctactggcgggcggctaactatctgtcagta
ggtcagatctacctgcaggacaatccgttgcttaccgagccgctcacactggaacacgtt
aaggcacggctgctcggccactggggaaccacgccgggattgaattttatctacgcccac
ttgaaccgcgtgatcaaggcccacgatctcaatatgatctatgtgacgggaccaggccac
ggtgctccggggctggtcgctaacacctggctagagggcagttacactgaagtctatcca
aatgttccccagaacgcggcgggcatgcagcggctattcaagcagttctccttcccgggc
ggcataccaagtcacgtcgccccggaaacgccaggttcaattaacgaaggcggcgaactc
ggctatgccttagcccatgcctacggcgcagtgtttgataacccggacctgatcgccgcc
tgtgtagtgggcgatggcgaggccgagaccggccccctcgccacggcctggcattccaac
aaatttctcaaccctgcgtgcgacggcgcggtactgccgatcctccatctgaacggctac
aaaatcgccaaccctaccgtgctggcgcgcatcagccgtgaggatttaaaaaacctgctt
gttggctacggctatcacccctatgtggtggaaggtgataaaccggagcaaatgcacccg
ctgatggcggctactctcgaccaggtagtggccgaaattcaaacgattcaacacgctgcg
cgcagccaaggcgctaccccctgcacacgctggccaatgatcgttctgcggaccccgaag
ggctggaccggccccaaggaagtcgacggtaaaaaaaccgagggctactggcgctcacac
caggtaccgttggcccaactggctgacaaaccggaacacctgcggctactagaagaatgg
atgaagagctaccgtcccgaggaattgttcgacggacaaggtaccctgcggccagaactg
gcggcgctagcaccccagggcgagcggcgcatgggcgccaacccacacgctaacggcggg
ctgttactcaaggatctgcggttacccgagttccgcgattatgccattagcataaccggt
cccggcgcggagctggcggaggcaactcgagtcatgggcggctatttacgcgacgtgatg
aagctgaacatggataaccgaaatttccgcgtaatgggaccggacgagaccagttccaac
cgcctcgatgccttgttcgaagtgactgatcgtacctggatggcaaaaacactgccagag
gacgagcaccttgcgccggatggccgagtgatggagatcctctccgaacacacctgccag
ggctggctagaaggctatctgctcaccggccgacacggcctattttcctgctacgaagcc
ttcattcacattgtcgattccatgttcaaccagcatgccaaatggcttaaagtcaccggc
aaggaaattccttggcgccgccccatcgcctcgctcaactatctcctaacttcccatgtg
tggcgccaagaccacaacggtttttcacatcaagatcccggcttcatcgatcacgtcgtg
aacaagaaggcggatgtgatccgagtttatctaccgccggacgccaatacactcctatgc
gtcaccgaccactgcctgcgttcgcgcaactttattaacgtcatcgtcgccggtaagcag
ttccagccccagtggctcgccatggatgcggccgtcaagcactgcgccgcaggcatcggc
atctggcggtgggccagcaatgaccagggcagcgaaccagacgtagtgatggcctgtgct
ggtgacgtgccaaccctggagaccttagcggcagtggatattctacgccatcatctgccc
gaacttaaagtgcgggttatcaacgtggtggatctcatgaccctgcaggacaaagaggag
catccccatgggctctcgcacaaggacttcgatacgctttttactaccaataaacccatc
atctttgcctaccatggttatccttggttgattcatcgcctcacctaccggcgcactaat
cacaagaatctacacgtacgcggttacaaggaagagggaacgaccaccaccccctttgac
atggtcgtccttaacgatatggatcggtttgacctggtagcggatgtcatcgatcgcgtg
cctaagctaggatcaacggcagcctatctcaaacaatggctccgggacaaacatatcgaa
cataagcaatacatcacccagcacggggtggatatgccagaggtgacgcaatggcaatgg
ggcaagagcggcggttga

DBGET integrated database retrieval system