KEGG   Nitrosococcus watsonii: Nwat_3050Help
Entry
Nwat_3050         CDS       T01266                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nwa  Nitrosococcus watsonii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nwa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nwat_3050
   00030 Pentose phosphate pathway
    Nwat_3050
   00051 Fructose and mannose metabolism
    Nwat_3050
   00052 Galactose metabolism
    Nwat_3050
   00500 Starch and sucrose metabolism
    Nwat_3050
   00520 Amino sugar and nucleotide sugar metabolism
    Nwat_3050
  Nucleotide metabolism
   00230 Purine metabolism
    Nwat_3050
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nwat_3050
Enzymes [BR:nwa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Nwat_3050
    5.4.2.8  phosphomannomutase
     Nwat_3050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3236665..3239166
Genome map
AA seq 833 aa AA seqDB search
MAGKFSFFRKQSKHSLQPKEKKALGNYTFVAFLTTGFIFVGLALLFYQHWLLSSGQQFRK
LIQLETQRQAVAVHAKIRSYAETLTSMARNPVLLRLVENQDKRLLRLKEQELKYAFPGAI
GVRILPPGINDIDKQATPPLSYSSLALLRAAEESSGATLAEIHLLGHSGQYVAMAHRLLS
PDGEVAGVLFLTLEPSVFTKALSQPGLAGGYLELRQGAKQQQAFASYGNRQLASTPPQGL
IPIEGSRWQLAYWAPIQERGENTHLIFWGGLIFGLLALGLIFYARDRLFARFLREDLMTL
VNLVRDLQRSQLQGRYKIHLPAFKGAAAVIQRMASDKQVTGETIAPGMAFREDAFSDEDF
QTAESMKVKEQPLKQSGRIAPSIFKAYDIRGVVGKTLTPESVYEIGRAIGSEARAQSQQN
IIVGRDGRLSGPELAHKLIEGLRATGCDVVDIGVVPTPLLYFAAQYLSTGSGVMLTGSHN
PPDYNGMKIMLRGETLALEAIQALRRRIEAEDYTRGAGDLQTVDVVPDYIERVTSDVKLT
RPLKIVVDCGNGAAGEVAPRLFRALGSEVSELYCEIDGQFPHHHPDPSQAENLEDLIAKV
KATGADLGLAFDGDGDRLGVIDSQGHIIWPDRQLMLYAMDVLSRHPGATILYDIKCSRHL
DQVITEYGGSPLMWKTGHSLIKAKMRETGALLAGEMSGHLFFKERWFGFDDALYAGARLL
EILAADTRSSGEIFAALPNGVSTPELRIEMAEGEHFQFMEKLLHQAEFPEAAVTTIDGLR
VDFEEGWGLVRPSNTTPCLVLRFEANDAEALERIEDNFRRLLLEVDPSLILPF
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
ttggctggtaaattttccttctttaggaagcaaagcaaacactcattacagcctaaagaa
aagaaggcattaggaaactataccttcgtggcttttttaaccacgggatttatttttgtg
ggtttggcgctgcttttctaccaacattggttactttcttctgggcaacaatttaggaaa
ttgattcaattagagactcagcgccaggcagtggccgtacacgcaaaaatccgctcctat
gctgaaactctcacctccatggcacgtaatcccgtacttttacgattagtcgagaatcaa
gataaacgattattgcgactcaaggagcaagaactgaaatacgcttttcctggagcgata
ggcgttcggattttaccaccagggataaatgacattgataaacaggcaacgccaccccta
agttattcaagcctagccctgttgcgggcggcagaagagagcagtggggcaacgcttgcg
gaaatacacttgttaggccactcgggacaatatgtggctatggcccaccgcctcctctca
ccagatggagaggttgcaggcgttttgttcctaacccttgagcctagtgtatttacaaaa
gctctaagccagccgggtttagcaggcggttacctggaattacgccagggtgcgaagcag
cagcaggcatttgctagctatggaaataggcaattagcaagcactcctccccaagggctt
atccctattgaaggtagtcgttggcaattggcctattgggcacctatccaagagagagga
gaaaacactcatcttatcttttggggaggattgatttttggattgctggcactaggcctg
attttttatgctcgagatcggctatttgcacgttttttgcgggaagatttgatgacctta
gtgaatttggtccgtgacttacaaagaagccagctacagggccgctataaaatccattta
cccgcttttaagggagcagcagccgtcatccagcgtatggcctcggacaaacaggtcaca
ggagaaaccatcgcccccgggatggctttcagggaagatgccttcagtgatgaggatttt
caaacagcagagagcatgaaagtgaaagaacagccccttaaacagagcggccgcatcgcc
ccctctatttttaaagcctatgatattcgcggtgtggtaggaaaaacactcacaccggag
agtgtatatgaaattgggcgcgccattggtagcgaggcccgtgcgcaaagccagcaaaat
attatcgtgggtcgagatggtcgcctttctggtcccgaattagcccataaacttatcgag
ggacttcgagcaacgggctgtgatgtagtcgacattggcgtggtgccgactccgctgctg
tattttgccgcgcaatatctaagtaccggctcaggggtgatgctaacgggaagccataat
ccccctgactataacggtatgaaaattatgctgcgcggcgagacacttgcactagaggcc
attcaggctttgcggcgtcgaatcgaagcagaggattatacccgtggcgcgggtgattta
cagacagtggatgtggtccctgattacatcgagcgggtaactagcgatgtgaaacttacc
cgtcccttaaaaattgtagtggactgcggcaatggggccgctggcgaagtcgcccctcgc
ctattccgagcgcttggcagtgaagttagcgaattatattgcgagattgacggtcaattt
cctcaccaccatcctgatccgagtcaagcagaaaatttagaagatttgatcgccaaggta
aaagcaacgggtgcagatttagggctggcttttgatggtgatggtgatcggttgggggta
attgattctcagggccatattatttggcctgatcgccagctgatgctttatgccatggat
gtcctttcccggcatccaggggctaccatcctttatgatatcaaatgctcccgtcattta
gatcaggttattactgaatatggaggcagcccgttgatgtggaaaacggggcactccctt
attaaagccaagatgagagagaccggtgcccttttagcaggcgaaatgagcggtcatctc
tttttcaaggaacgctggtttggatttgatgatgctctctatgcaggggctcgcctgctg
gagattttggctgccgatacccggtcctcgggggaaatatttgctgccttgccaaatggg
gtaagcacgccggagttgcgaatagagatggccgagggagagcattttcagtttatggaa
aaattactgcaccaagccgagttcccggaagctgctgtaaccaccatcgacgggctacgg
gtggattttgaggagggatgggggctggtccgcccttcgaataccacgccttgcttagtt
ttacggtttgaggccaatgatgctgaagccttggagcgtattgaagataactttaggcgt
ttactattggaagtagatcccagtctgatattaccgttttaa

DBGET integrated database retrieval system