KEGG   Neisseria weaveri: SAMEA3174300_0902Help
Entry
SAMEA3174300_0902 CDS       T04355                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nwe  Neisseria weaveri
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:nwe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAMEA3174300_0902 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    SAMEA3174300_0902 (thlA)
   00640 Propanoate metabolism
    SAMEA3174300_0902 (thlA)
   00650 Butanoate metabolism
    SAMEA3174300_0902 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    SAMEA3174300_0902 (thlA)
   00072 Synthesis and degradation of ketone bodies
    SAMEA3174300_0902 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAMEA3174300_0902 (thlA)
   00310 Lysine degradation
    SAMEA3174300_0902 (thlA)
   00380 Tryptophan metabolism
    SAMEA3174300_0902 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAMEA3174300_0902 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAMEA3174300_0902 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAMEA3174300_0902 (thlA)
Enzymes [BR:nwe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAMEA3174300_0902 (thlA)
Exosome [BR:nwe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAMEA3174300_0902 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(984998..986179)
Genome map
AA seq 393 aa AA seqDB search
MIRDVVIVAAKRTAVGSFMGGLSALRAPELGAAVIRDLLLQTGVAADEVDEVVMGHVLTA
GVGQNPARQAAMLAGLPVEIPATTVNVVCGSGLKAVQMAAQAVACGDAEIVIAGGQESMS
QSPHFVRMRSGIKMGDAGLTDSMVSDGLTDVYHQYHMGITAENIAERLHISREAQDIFAL
QSQQKAVQARSSGKFAEEITAVAVPQRRGEAVWFDQDEYIKADASAEKLAALRPAFKKDG
TVTAGNASGLNDGAAAVMVMSLEKAEALGLKPLAFIRAYAATGIEPEMMGLGPVAAIGKT
LQKAGWTVGDVDLFEANEAFAAQALGVMQQAGLPSEKINVNGGAIAIGHPIGASGCRILV
TLLHEMRRSNKRKGVAALCAGGGMGLALAVERE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatacgcgatgtggtgattgttgccgccaaaagaacggcggtcggcagttttatgggc
ggtttgtctgctttgcgtgcgccggaattgggtgcggcggtgattcgggatttgctgttg
cagacaggcgtagcggcagatgaagtggacgaagtggtgatgggccatgtgctgacggcc
ggtgtcggtcagaatcctgcccgtcaggctgcgatgttggccggattgccggtggaaatt
ccggcaacaacggtgaatgtggtatgcggttccggtttgaaagcagtgcagatggctgcc
caggccgtggcctgcggcgatgcggaaatcgtgattgccggcgggcaggagtcgatgtcg
caaagtccgcactttgtccgtatgcgcagcggtatcaaaatgggcgatgccggcttgacc
gacagcatggtttcagacggcctgaccgatgtgtaccatcaataccatatgggtattacg
gcggaaaatatcgcagagcgtctgcatatttcccgggaagcacaagacatttttgccttg
cagtcgcaacaaaaagcggtgcaagcccgaagcagcggcaaatttgccgaggaaatcact
gccgttgccgtgccgcagcgtcggggcgaagcggtgtggtttgatcaagacgaatacatt
aaagccgatgcttcggcggagaaactggcggccttgcgtcccgcatttaaaaaagacgga
acggtaacggcaggcaatgcttcgggtttgaacgacggtgcggcagcggtaatggtgatg
agtttggaaaaagccgaagcgctcggattaaagccgctggcctttatccgcgcctatgcg
gccaccggtatcgagcctgaaatgatgggtttggggccggtggcggccatcggcaagact
ttgcagaaagccggttggacagttggcgatgtcgatttgtttgaagccaatgaagcgttt
gccgcccaagcgttgggtgtcatgcagcaggcaggattgccgtctgaaaaaatcaatgtc
aacggcggtgcgattgccataggtcatcctatcggtgcttcgggctgccgtattttggtg
acgttgctgcacgagatgcgccgcagcaataagcgtaaaggcgtggcggcattatgtgcc
ggcggcggtatgggattggcattggcggtagaaagggagtaa

DBGET integrated database retrieval system