KEGG   Nitrobacter winogradskyi: Nwi_0055Help
Entry
Nwi_0055          CDS       T00276                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00260  Glycine, serine and threonine metabolism
nwi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nwi01100  Metabolic pathways
nwi01110  Biosynthesis of secondary metabolites
nwi01130  Biosynthesis of antibiotics
nwi01230  Biosynthesis of amino acids
Module
nwi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nwi_0055
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Nwi_0055
Enzymes [BR:nwi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Nwi_0055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABA03323
JGI: Nwi0055
UniProt: Q3SWL8
Position
complement(66899..68143)
Genome map
AA seq 414 aa AA seqDB search
MSSLPNSFRSGPDERGHFGMFGGRFVAETLMPLILDLERAYADAKSDAAFQRDMARYRKD
YIGRPSPLYFAERLTDHLREISAASGGAGGAKIYLKREELNHTGSHKVNNVLGQILVARR
MGKKRIIAETGAGQHGVATATLCARFGLDCVVYMGAVDVARQEPNVIRMEMLGAKVVPVQ
SGTRTLKDAMNEALRDWVTNVHDTFYCIGTVAGPHPYPMMVRDFQSIIGEETRRQMQEAE
GRLPDSLIACIGGGSNAMGLFHPFLDESSVEIFGVEAAGHGLDKQHAASLTGGRPGVLHG
NRTYLLMNGDGQIEDAHSISAGLDYPGIGPEHSWLHETGRVTYLSATDEEALGAFQLLSR
LEGIIPALESAHAIARVIELAPGRTKDHLMVVNLSGRGDKDVPQVGDILKGRKK
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagttctctccccaattctttccggtccggccccgacgagcgcgggcatttcggcatg
ttcggcggccgcttcgtggcggaaacgctgatgcccttgatcctcgatcttgagagggcc
tatgccgacgccaaaagcgacgccgcgttccagcgcgacatggcgcgctatcgcaaggac
tatatcggccggccgtcgcccctgtatttcgccgagcgtctgaccgaccaccttcgggag
atttccgcggcctcgggcggcgccggcggcgcaaaaatctacctgaagcgcgaggagctc
aaccacaccggctcgcacaaggtcaacaatgtgctgggccagattctggtggcgcggcgc
atgggcaagaagcgcatcatcgccgagaccggcgcgggccagcacggcgtcgccaccgcg
acgctgtgcgcgcgcttcggcctggactgcgtggtctatatgggtgcggtggacgtggcg
cggcaggagccgaacgtcatccgcatggaaatgctgggggcgaaagtggtgccggtgcag
tccggcacccggacactgaaggatgcgatgaacgaggcgctgcgcgactgggtgaccaac
gtgcacgacaccttctattgcatcggtacggtggcggggccgcatccctatccgatgatg
gtgcgcgacttccagtcgatcatcggcgaggaaacacgacggcagatgcaggaggcggaa
ggccgtctgccggattcgctgatcgcctgcatcggcggcggctccaacgcgatgggattg
tttcatcccttcctcgatgaatcctcggtggagattttcggcgtcgaggcggcgggacac
gggctcgacaagcagcacgcggcctcgctcaccggcgggcggcccggcgtgctgcacggt
aatcgcacctatctcctgatgaatggcgacggtcagattgaggacgcgcattcgatttcc
gcaggcctggactatcccggcatcgggccggagcattcatggctgcacgagaccggccgc
gtcacctatctttccgcgaccgacgaggaagcgcttggcgcgtttcaactgctgtcgcgg
ctggaaggcatcatcccggcgctggaatcggcgcatgcgatcgcgcgcgtcatcgaactc
gcgccagggcggacgaaggatcacctgatggtggtcaacctctcgggccgcggcgacaag
gacgtgccgcaggtcggcgatatcctgaagggcaggaagaagtga

DBGET integrated database retrieval system