KEGG   Nitrobacter winogradskyi: Nwi_0229Help
Entry
Nwi_0229          CDS       T00276                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00260  Glycine, serine and threonine metabolism
nwi00750  Vitamin B6 metabolism
nwi01100  Metabolic pathways
nwi01110  Biosynthesis of secondary metabolites
nwi01120  Microbial metabolism in diverse environments
nwi01230  Biosynthesis of amino acids
Module
nwi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Nwi_0229
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Nwi_0229
Enzymes [BR:nwi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Nwi_0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABA03497
JGI: Nwi0229
UniProt: Q3SW44
Position
259851..261269
Genome map
AA seq 472 aa AA seqDB search
MTHYLSTRGENQKLGFSDVMLAGLARDGGLYVPEVWPQLRLDTVAAFFGRPYSEVAVEVI
RPFVGGDIADVDLARMANEAYATFRHPAVVPLDQIGSQQFLLELFHGPTLAFKDVAMQLL
SRLMDHVLARRGQRTTIVVATSGDTGGAAVDAFANRANVDLIALFPDGRISEVQRRMMTT
TAAPNVHALAVKGTFDDCQAIVKGLFNNHRFRDEVSLSGVNSINWARIVAQVVYYFTSAV
ALGAPARAVDFTVPTGNFGDIFAGYVAKRMGLPVRRLRIAANINDILPRTLKTGIYEVRE
VHATSSPSMDIQVSSNFERLLFEATGRDAAQVRALMASLQQSGRFALPESVLAAMRADFD
AECADETETAATIRTAWREAGDLLDPHTAVALTVADRDAAESRVPNIVLATAHAAKFPDA
VEAACGVRPPLPAWLDGLMTRPERITIVNNDQAEIERFVLSVSRAANHGVTG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgacgcactatctttcgacacggggagagaatcaaaaactcggtttctctgatgtgatg
ctggccggactcgcacgggacggcggtctctacgtgccggaggtctggccgcaattgcgg
ctcgatacggttgccgcctttttcggcaggccctactcggaggtagccgttgaggtgatc
cggccgttcgtgggcggagatatcgccgacgtcgacctcgctcgcatggccaacgaggct
tatgcgaccttccggcaccccgcggtggtcccgctcgatcagataggctctcaacagttc
ctgctggaactgtttcacggtccgacgctggcgttcaaggacgtggcgatgcagttgctg
tcgcggctgatggaccacgttctggcgagacgcggccagcgcaccaccatcgtcgtggcc
acctcgggtgacaccggcggcgcggcagtggatgcattcgccaaccgtgcgaatgttgat
ctgatcgccttgttcccggacggccgcatttccgaggtgcagcgacgcatgatgacgacg
acggccgcgccgaatgttcatgcgcttgcggtcaagggcacgttcgacgactgccaggcg
atcgtgaagggcctgttcaacaatcaccgcttccgcgacgaggtatcgctctcgggagtc
aactcgatcaactgggcgcggatcgttgcacaggtagtgtattacttcacctctgcggtc
gcgctcggcgcgcccgcgcgcgccgttgattttaccgtgccgaccggtaatttcggcgac
atcttcgccggttacgtcgcaaagcgcatgggactgccggtacgccggctgcggatcgcc
gccaacatcaatgatattctgccgcgcacgctgaagaccggaatttatgaggtgcgcgag
gttcacgccacctcttcgccgtcgatggacattcaggtgtcgtcgaacttcgaacggctg
ttgttcgaggcgaccgggcgtgatgccgcgcaggtgcgtgcgctgatggcctcgttgcag
cagtccggccgtttcgcgctaccggagtcggttctggccgcgatgcgcgcggatttcgat
gccgaatgtgccgacgaaacggagaccgcggccacgatccgcacggcgtggcgcgaagcc
ggagatctgctcgacccgcatacggctgttgccttgacggtggccgatcgtgacgcggcg
gagtcgcgcgttcccaacatcgtgctcgccaccgcccatgccgccaagttccctgacgcc
gttgaggcggcctgcggcgtacggccgccgttgccggcctggctcgacggcttgatgacc
cggcccgagcggatcacgatcgtgaacaacgatcaggcagaaatcgaacggttcgtgctg
tccgtcagccgcgccgccaatcacggagttaccggatga

DBGET integrated database retrieval system