KEGG   Nitrobacter winogradskyi: Nwi_0247Help
Entry
Nwi_0247          CDS       T00276                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nwi01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:nwi00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
276758..278092
Genome map
AA seq 444 aa AA seqDB search
MTRDIVPHPPEASQPMPIRIDSRNADFVPRFKAFLATKREVSADIEAATRAIVDDVAARG
DAALIEATCKFDRLSVDAAGLRFTAAEIDAAVAACDAATLDALKLARDRIETFHRRQLPK
DDRFIDALGVELGSRWTAIEAVGLYVPGGSAAYPSSVLMNAVPAMVAGVARVVMVVPSPA
GRINPLVLAAARLGGVSEIYRVGGAQAVAALAYGTATIAPVAKIVGPGNAYVAAAKRQVF
GKVGIDMIAGPSEVLVIADQTGNAGWIAADLLAQAEHDANAQSILITDSEALAADVERAV
ETQLATLPRAGIARASWNDFGAVILVTDLDEAVVLADSIAAEHLEIMTADPEGLAARIRN
AGAIFLGPHTPEAIGDYVGGSNHVLPTARSARFSSGLGVLDFMKRTSILKCGPDQLRALG
PAAMTLGKAEGLDAHARSVGVRLN
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgtgatattgttccacatccgccggaagcatcccagcccatgccgatccgcatc
gatagccgcaacgccgatttcgtcccgcgcttcaaggcgtttcttgcgaccaagcgcgag
gtctcggccgatatcgaggcggccacgcgcgctatcgtcgacgacgtggcggcgcggggc
gatgcggcgctgatcgaggccacgtgcaagttcgaccggctgtccgtcgacgccgcgggt
ctccgcttcaccgcagccgagatcgacgccgccgtggcggcttgcgacgccgcgacgctg
gacgcgctgaagctggcgcgcgaccggatcgagacctttcatcgccgccagttgccaaag
gacgaccgtttcatcgacgcgctcggcgtcgaactcggctcgcgctggaccgcgatcgag
gcggtcggactttacgtgccgggcggctccgcggcctatccttcctcggtgctgatgaat
gcggtgccggctatggtcgccggggtcgcgcgcgtcgtcatggtggtgccctcgccggcg
ggcaggatcaatccgctggtgctggcggcggcgcggctcggcggcgtctccgaaatctat
cgcgtgggcggcgcgcaggcggtcgccgcactcgcctacggcaccgcgaccatcgcgccg
gtggccaagattgtcggacccggcaacgcctatgtcgccgccgccaagcggcaggtgttc
ggcaaggtcggcatcgacatgatcgccggtccctcggaggtgcttgtcatcgccgaccaa
accggcaacgccggctggatcgccgccgatctgctcgcgcaggcggagcatgacgccaac
gcgcaatcgatcctgatcaccgacagcgaggcgctcgccgccgatgtcgagcgcgccgtg
gagacgcaactcgcaacgttgccgcgggccgggatcgcgcgcgcctcctggaacgacttt
ggcgccgtcattctggtgacggatctcgatgaagcggtggtgctggcggattcgatcgcc
gcggaacatctggagatcatgaccgccgatcccgaaggcctcgcagcgcggatccgtaat
gccggcgcgatctttctcgggccgcatacgccggaagccatcggcgattatgtcggcggc
tccaatcacgtcctgccgacggcacgctccgcgcggttttcgtcgggccttggcgtgctt
gacttcatgaagcgaacgtcaatcctcaaatgcgggccggaccagttgcgggcgctgggg
ccggcggcgatgaccctgggcaaggccgagggcctcgatgcccatgcccgttcggtcgga
gtgcgtctcaactag

DBGET integrated database retrieval system