KEGG   Nitrobacter winogradskyi: Nwi_0279Help
Entry
Nwi_0279          CDS       T00276                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00071  Fatty acid degradation
nwi00072  Synthesis and degradation of ketone bodies
nwi00280  Valine, leucine and isoleucine degradation
nwi00310  Lysine degradation
nwi00362  Benzoate degradation
nwi00380  Tryptophan metabolism
nwi00620  Pyruvate metabolism
nwi00630  Glyoxylate and dicarboxylate metabolism
nwi00640  Propanoate metabolism
nwi00650  Butanoate metabolism
nwi00900  Terpenoid backbone biosynthesis
nwi01100  Metabolic pathways
nwi01110  Biosynthesis of secondary metabolites
nwi01120  Microbial metabolism in diverse environments
nwi01130  Biosynthesis of antibiotics
nwi01200  Carbon metabolism
nwi01212  Fatty acid metabolism
nwi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Nwi_0279
   00630 Glyoxylate and dicarboxylate metabolism
    Nwi_0279
   00640 Propanoate metabolism
    Nwi_0279
   00650 Butanoate metabolism
    Nwi_0279
  Lipid metabolism
   00071 Fatty acid degradation
    Nwi_0279
   00072 Synthesis and degradation of ketone bodies
    Nwi_0279
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Nwi_0279
   00310 Lysine degradation
    Nwi_0279
   00380 Tryptophan metabolism
    Nwi_0279
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Nwi_0279
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Nwi_0279
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nwi_0279
Enzymes [BR:nwi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Nwi_0279
Exosome [BR:nwi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nwi_0279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C UCMA
Motif
Other DBs
NCBI-ProteinID: ABA03546
JGI: Nwi0279
UniProt: Q3SVZ5
Position
313329..314516
Genome map
AA seq 395 aa AA seqDB search
MTEAVIVSTARTPIGKAYRGALNATEGATLLGHAIGEAAVRAGVDPQEIEDVVMGVAMQQ
GATGGNIARKALLRAGLPVTVAGATIDRQCASGLQAIALAARSVLFDGVGIAVGGGGESI
SLVQNEHANTFHAEDPALLEIKREVYMPMIDTAEVVAKRYGISRQAQDEYALESQRRTAA
AQQEGRFKDELAPISTRMAIVDKETGNVTFRDVTLSQDEGPRPDTSAEGLAGLKPVRGEG
CTITAGNASQLSDGASAAVIMSGTEASRRGLNPLGIFRGFVSAGCEPDEMGIGPVFAVPR
LLKRHGLTVGDIDLWELNEAFAVQVIYCRDRLGIDPEKLNVDGGAIAVGHPYGMSGARLA
GHALIEGRRRKAKYAVVTMCVGGGMGAAGLFEVLQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccgtgattgtctccaccgcccgcacgccgatcggcaaggcctatcggggc
gctctcaacgccactgaaggagcgaccctgctcggccatgccatcggagaagccgctgtc
cgcgccggggttgatccacaggagatcgaggacgtggtgatgggcgtggccatgcagcag
ggcgccactggcggcaacatcgcccgcaaggcgctgcttcgcgccgggctccccgtgacc
gtcgccggcgccaccatcgaccgccaatgcgcctcgggccttcaggcgatcgcgctggcc
gcgcgttccgtcctgttcgacggcgtcggaatcgcggtcggcggcggcggcgagtcgatc
agcctggtgcagaacgagcacgccaacacctttcacgcagaggatccggcgcttctggag
atcaagcgcgaggtctacatgcccatgatcgacaccgcggaagtggtcgcgaagcgctac
ggcatctcgcgccaggcgcaggacgaatatgcgctcgaaagccagcgccgcaccgccgcc
gcgcagcaggagggccgattcaaggacgaactggcgccgatctccacaagaatggcgatc
gtcgacaaggaaaccgggaacgtcacgttcagggacgtgacgctgtcgcaggacgaaggt
ccgcgtcccgatacgtcggctgaaggtctcgccgggctcaagccggttcgcggcgaaggc
tgcaccatcaccgccggcaatgccagccagctgtcggacggcgcgagcgcggccgtgatc
atgagcggcacggaggcgtcgaggcgcggcctgaatccgctcggcatcttccgcggtttc
gtctcagccggctgcgagcctgatgaaatgggcatcggcccggtgttcgcggtgccgcgc
cttctgaaacgacacggcctcaccgtgggagacatcgatctttgggagttgaacgaagcg
ttcgcggtgcaggtgatctattgccgcgacaggctgggcatcgatcccgaaaaactcaac
gtcgacggcggagcgatcgcggtcggtcatccctacggaatgtcgggcgcgcgccttgcc
ggtcatgccctgatcgagggacgccggcgcaaggcgaaatatgccgtggtcaccatgtgc
gtcggcggcggcatgggcgcggccggcctattcgaggtgcttcagtaa

DBGET integrated database retrieval system