KEGG   Nitrobacter winogradskyi: Nwi_0281Help
Entry
Nwi_0281          CDS       T00276                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Nwi_0281
Enzymes [BR:nwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Nwi_0281
Exosome [BR:nwi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Nwi_0281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
315223..316782
Genome map
AA seq 519 aa AA seqDB search
MPLWRVAPPPRARKFENNVMVTHVLAIDQGTTSSRAIVFRADLTVAAIAQQEFPQHFPAS
GWVEHEPEDIWTSTVATCRQAMKKAGVTPKDIAAIGITNQRETTVVWDRVTGKAVRRAIV
WQDRRTADVCARLKAEGHEPAISAKTGLIIDPYFSGTKVAWILDSVPGARARAMRGELMF
GTVDCYLLWRLTGGKVHATDATNASRTMLFDIHTGHWDDALLDILRIPRAMLPEVKDSSA
HFGDSAPELFGAPIAIRGIAGDQQAAVVGQACFTPGMIKSTYGTGCFALLNTGATPVAST
NKLLTTIAYQLNGERTYALEGSIFVAGSAVQWLRDGLGLIKNASETEPLAEQSDPVQSVY
LVPAFVGMGAPYWNPNVRGALFGLTRNTGPAELAHAALESVCYQTFDLWEAMRADWPADA
AAHTVLGVDGGMTASNWTMQRLADLLGVPVDRPVIQETTALGAAYLAGLSAGVYPEPSRF
ADNWRRDRCFKPAMSAETRARKLKGWTAAVRGVLASDEG
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
ttgccactctggcgcgttgcgccgccgccgcgagcccgcaagttcgagaacaacgtcatg
gtcacccacgtcctcgccattgatcaaggcaccacatcgtcacgggccatcgtgtttcgc
gccgacctcaccgtcgccgcgatcgcgcagcaggaattcccgcagcactttccggcgtcg
ggctgggtcgaacatgagccggaagacatctggacctcgaccgttgcaacctgccggcag
gcgatgaagaaggcgggcgtcacgccgaaggacatcgccgccatcggcatcaccaatcag
cgggaaaccacggtggtctgggaccgcgtcaccggaaaggcggtgcgtcgcgccatcgtg
tggcaggaccggcgcactgcggatgtctgcgcgcggctgaaagccgagggtcatgagccc
gcgatatcggcgaaaaccggcttgatcatcgacccctatttttccggcaccaaggtcgcc
tggatactcgattcggttccgggggcgcgggcgcgggcgatgcgcggtgagctgatgttc
gggaccgtggattgttatctcttgtggcggctgaccggcggcaaggtgcacgcgaccgac
gccaccaatgcgtcgcgcaccatgctgttcgacattcacaccgggcactgggatgacgcg
ctcctggatattctccggataccgcgtgcgatgctgccggaggtgaaggattcctcggcg
catttcggcgacagcgcgcctgaattgttcggcgcgccgatcgcgatccggggcatcgcc
ggcgatcagcaggcggcggtggtgggtcaggcgtgcttcacgcccggaatgatcaagtcg
acctacggcaccggctgcttcgcgctgctcaacaccggcgcgacgccggtcgcctcgacc
aacaagctgctgaccacgatcgcctatcaactgaacggcgagcgtacctacgcgctggaa
ggttcgatcttcgtcgccggctcggcggtgcagtggctgcgggacggcctgggcctcatc
aagaatgcttcggagacggagccgctggcggagcagtccgatcccgtccaatcggtgtat
cttgtgccggcgttcgtcggcatgggtgcgccgtattggaacccgaatgtgcgtggcgcg
ctgttcggactgacccgcaacaccgggccggcggaactcgctcacgcggcgctggaaagc
gtctgctaccagacatttgatctttgggaggcgatgcgcgccgattggccggccgacgcc
gccgcgcacaccgtgctgggggtcgacggcggcatgacggcctccaactggaccatgcag
cgtctcgcggacctgctcggggtaccggtcgaccggccggtcattcaggagaccacggcg
ctgggcgcggcgtacctcgcggggctctccgcgggcgtttatccggagccgtcgcggttc
gccgacaattggcggcgtgaccgctgtttcaagccggccatgagcgccgagacgcgtgcg
cggaagctcaagggatggacagccgcggtgcgtggcgtgctggcgagcgacgaggggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system