KEGG   Nitrobacter winogradskyi: Nwi_0287Help
Entry
Nwi_0287          CDS       T00276                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
nwi  Nitrobacter winogradskyi
Pathway
Sulfur metabolism
Metabolic pathways
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:nwi00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:nwi02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
324262..324819
Genome map
AA seq 185 aa AA seqDB search
MINKFIGAVLGTCLVLLVMNLIARAVFAPAVPAKPGYKIDVKEEPAAVQKDDKPVAASKA
AAASKEADVAAAVSLGKRLQAASAENGAVVAKKCAACHTFEKGGPNRVGPNLYGIVGEPR
GQGHDFNFSAAMKAKGGTWTLDELDKFLANPKEYIPGTAMSFVGVPKDSDRADLIAYLRK
NSDKP
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgatcaataaatttattggtgcggttctgggcacctgcctcgttttgctggtcatgaat
ttaatcgcgcgggcggttttcgcgccggccgtgccggcgaagccgggctataaaatcgac
gtcaaggaagagccggcggccgttcagaaggacgacaagccggtggccgcgagcaaggct
gcggccgcaagtaaggaagccgacgtcgcggcggcggtgtcgctggggaagaggctgcaa
gccgcttcggccgagaacggcgctgtcgtcgccaagaaatgcgccgcctgccataccttc
gagaagggcggaccgaaccgcgtcggccctaatctttacggcatcgtcggcgagccgcgc
ggccagggtcatgacttcaatttctcggcggccatgaaggccaagggcggcacctggacg
ctcgatgaactggacaagtttctggccaacccgaaggaatacattccggggacggcgatg
tcttttgtcggcgttccgaaggacagcgaccgtgccgacctcattgcctatctgcgcaag
aattccgacaagccatag

DBGET integrated database retrieval system