KEGG   Nitrobacter winogradskyi: Nwi_0361Help
Entry
Nwi_0361          CDS       T00276                                 

Definition
phosphoglucomutase/phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nwi_0361
   00030 Pentose phosphate pathway
    Nwi_0361
   00051 Fructose and mannose metabolism
    Nwi_0361
   00052 Galactose metabolism
    Nwi_0361
   00500 Starch and sucrose metabolism
    Nwi_0361
   00520 Amino sugar and nucleotide sugar metabolism
    Nwi_0361
  Nucleotide metabolism
   00230 Purine metabolism
    Nwi_0361
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nwi_0361
Enzymes [BR:nwi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Nwi_0361
    5.4.2.8  phosphomannomutase
     Nwi_0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
407589..409088
Genome map
AA seq 499 aa AA seqDB search
MFPKPKSVLAPNTYAYESEPMVKATGFREYDARWLFGKEINLMGIQALGMGLGTLIGELG
QKKEIVTGHDFRSYSSSIKYALISGLLASGCKVHDIGLCMTPMAYFAQFELDVPCVAMVT
ASHNDNGWTGVKMGANRPLTFGPDEMTRLKEIVLGAAFAGRGGGSYEFHDNFPSRYIADL
TKRPKLKRRLKAVVACGNGTAGAFAPQVMEAIGCEVIPLDTELDHSFPKYNPNPEDMKML
HAIRDAVLENKADLGLGFDGDGDRCGVVDNTGEEIFADKVGVMLARDMSAIHKDAHFVVD
VKSTGLFVTDPVLQQQGARATYWKTGHSYMKRRTHELGALAGFEKSGHFFFNAPMGRGYD
DGLISAIAVCEMLDRAAGKSLADLKNALPKTWSSPTMSPHCADEAKYGIVDSVVKHFEDA
RANGDKVAGQPIRDLVTVNGIRVTAQDGSWGLVRASSNKPELVVVVESPVSEQRMRDMFE
AMDSVLRTHPEVGEYNQKI
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtttccgaagccgaagtccgttctggcgccgaatacctatgcctatgaatccgagccg
atggtgaaagcgaccggatttcgcgaatatgacgcgcgatggctgttcggcaaggaaatc
aacctgatgggcattcaggcgctgggcatggggctgggcacgctgatcggcgaactcggc
cagaagaaggagatcgtcaccggtcatgatttccgaagctattcgtcatccatcaagtac
gcgctgatttccggcctgctggcgtcgggctgcaaggttcacgacatcggactgtgcatg
acgccgatggcgtatttcgcgcagttcgagctcgatgtcccctgcgtcgccatggtgacg
gcctcgcataacgacaacggctggaccggcgtcaagatgggcgccaaccggccgctgacg
ttcgggccggacgagatgacgcggctcaaggagatcgtgctgggcgccgcctttgccggc
aggggaggcggttcctatgaatttcacgacaatttcccgtcgcgctacatcgcggatctg
acgaaacggccgaagctgaagcgcaggctgaaggccgtggtggcctgcggcaacggcacc
gccggcgcgttcgcgccgcaggtgatggaggcgatcggctgcgaggtcatcccgctggat
accgagctcgaccacagtttcccgaagtacaatccgaacccggaagacatgaagatgctg
cacgcgatccgcgatgcggtgctggaaaacaaggcggatcttggtctcggcttcgatggc
gacggtgaccgctgcggcgtggtcgacaacaccggcgaggaaatcttcgccgacaaggtc
ggcgtgatgctggcgcgcgacatgtcggcgatccacaaggatgcgcatttcgtggtcgat
gtgaagtcgacgggcttgtttgtcaccgatccggtgttgcagcagcagggcgcgcgggcg
acctactggaaaaccggccattcctacatgaagcggcgcacgcatgagcttggcgcactc
gccggtttcgagaagtcaggccacttcttcttcaacgcgccgatgggccgcggttacgat
gacgggctgatctcggcgatcgccgtgtgcgagatgctcgatcgcgccgccggcaaatcg
ctggccgatctgaagaacgccttgcccaaaacctggtcgtcgccgacgatgtcgccgcat
tgcgccgacgaggccaagtacggcatcgttgacagcgtggtgaagcatttcgaggacgcc
agggccaacggcgacaaggtggccggccagccgattcgtgatctcgtcaccgtcaacggc
atcagggtgacggcgcaggacggaagctgggggttggtgcgggcatcatcgaacaagccc
gaactggtggtcgtggtggaaagcccggtctccgagcagcggatgcgcgacatgttcgag
gctatggatagcgtgctgcgtacccatcccgaggtcggtgagtacaatcagaagatttga

DBGET integrated database retrieval system