KEGG   Nitrobacter winogradskyi: Nwi_0416Help
Entry
Nwi_0416          CDS       T00276                                 

Definition
lysophospholipase L1 and related esterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Nwi_0416
Enzymes [BR:nwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Nwi_0416
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Nwi_0416
Lipid biosynthesis proteins [BR:nwi01004]
 Fatty acid synthase
  Component type
   Nwi_0416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
467056..467811
Genome map
AA seq 251 aa AA seqDB search
MWSRLLPYGRPPEHLKHNDGDRTGRRAGSYGISFSTIERLTRGFVLLLLGAVLVLGAPAR
AADPVRIVVLGDSLSAGLGLSAADAFPAQLEKALKDKGVNVAISNAGVSGDTASGGLDRL
DWSVPAGTQGVILELGANDALRGIDPKVTRAALDEILKRLKARNIAILLCGMVAPPNYGD
EYAAQFGAIFSDLAKKHGVPLYPFFLEGVAANAELNQADGIHPTAAGVTTIVKNILSTVE
AFLDTLSERKT
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtggtccaggttgcttccgtatggaagacctccggagcacctgaagcacaatgacgga
gaccgcaccggccgccgcgctggctcatatggcatttctttttccacgatcgagaggttg
acgcgcggcttcgtgctgttgctgctcggcgcagtcctcgtcctcggagccccggcgcgg
gccgccgaccccgtcaggatcgtcgtgctcggtgattccctaagcgctggccttgggctt
tccgccgccgatgcatttcccgcgcaattggagaaggcgttaaaagacaagggtgtgaac
gtcgcgatcagcaatgccggcgtctccggcgacaccgcctccggcggtcttgaccggttg
gactggtccgttccggcgggcacgcagggcgtcatccttgaactcggcgcaaacgatgcc
ttgcgcggcatcgatcccaaggtgacgcgcgccgcgctggatgaaatcctcaaacgcctg
aaggcgcgcaacatcgcgatcctgctatgcggcatggtcgcgccgccgaactacggcgac
gaatacgcggctcaattcggcgcaatcttttccgatctcgcgaaaaaacatggcgtcccg
ttatacccgttctttctggaaggcgttgcggcgaatgccgaactcaatcaggcggacgga
attcatccgacggcggccggggtgacaacgatcgtcaagaatattctttccacggttgaa
gcctttctcgataccctttccgagcggaagacttga

DBGET integrated database retrieval system