KEGG   Nitrobacter winogradskyi: Nwi_0420Help
Entry
Nwi_0420          CDS       T00276                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00020  Citrate cycle (TCA cycle)
nwi00640  Propanoate metabolism
nwi00660  C5-Branched dibasic acid metabolism
nwi01100  Metabolic pathways
nwi01110  Biosynthesis of secondary metabolites
nwi01120  Microbial metabolism in diverse environments
nwi01130  Biosynthesis of antibiotics
nwi01200  Carbon metabolism
Module
nwi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nwi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nwi_0420
   00640 Propanoate metabolism
    Nwi_0420
   00660 C5-Branched dibasic acid metabolism
    Nwi_0420
Enzymes [BR:nwi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Nwi_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ABA03687
JGI: Nwi0420
UniProt: Q3SVK4
Position
471095..472294
Genome map
AA seq 399 aa AA seqDB search
MNIHEYQAKALLREFGVPVSRGVPVLQASEAEAAAETLGGPVWVVKSQIHAGGRGKGKFK
EASAGEKGGVRLARSIDEVKTFAGQMLGATLVTAQTGPAGKQVNRLYIEEGSDIDKEFYF
SALVDRETSRISFVVSTEGGMNIEEVAHKTPEKIVTFSVDPATGVMSHHGRTVARALRLR
GDLGKQAEKLVTQLYDAFIARDMAMLEINPLVVTKQGELRVLDAKISFDSNALYRHSDVV
ALRDESEEDAKEIEASRFDLSYVALDGQIGCMVNGAGLAMATMDIIKLYGMAPANFLDVG
GGATKDKVAAAFKIITADPNVKGILINIFGGIMKCDVIADGVVAAVKQVGLNVPLVVRLE
GTNVDAGKKIIRESGLNVLPADDLDDAAQKIVKAVKEVA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaatatcaggccaaggcgttgctgcgcgagttcggcgtgccggtttcg
cgaggggtgccggtgttgcaggcatcggaagcggaggccgcggccgaaacgctgggtggt
ccggtctgggtggtgaaaagccagattcacgccggcggccgcggcaagggcaagttcaag
gaagcttccgccggcgagaaaggcggcgtccgcctcgccagatcgatcgacgaggtgaag
accttcgccggccagatgcttggcgcgacgctggtcacggcgcagaccggccctgccggc
aagcaggtcaaccgcctttacatcgaggaaggctccgacatcgacaaggaattctacttc
tcggcgctggtcgaccgcgagacatcgaggatttcgttcgtggtctccaccgaaggcggg
atgaacatcgaggaggtcgcgcacaaaacgcctgagaagatcgtgaccttctcggtcgat
cccgccaccggcgtgatgagccatcacggccgcaccgtcgccagggcgctgagattgcgc
ggcgatctcggcaagcaggcggaaaagctggtgacgcagctttatgatgcgttcatcgcc
agggacatggcgatgctggaaatcaatccgctggtggtcacgaaacagggcgagctgcgc
gtgctcgacgccaagatatcgttcgacagcaacgcgctgtaccgccactccgatgtcgtt
gcgctgcgcgacgagagcgaggaagacgccaaggaaatcgaggcgtcgcggtttgatctg
agctacgtcgcgctggatggccagatcggctgcatggtcaacggcgcgggccttgccatg
gcgaccatggacatcatcaagctctacggcatggcgcccgcgaacttcctcgacgtcggc
ggcggcgccaccaaggacaaggtcgcggccgccttcaagatcatcactgccgatccgaac
gtgaagggcatcctgatcaatatcttcggcggcatcatgaaatgcgatgtcatcgccgac
ggcgttgtcgccgcggtgaaacaggtgggtctgaatgtgccgctggtggttcgcctcgaa
ggcaccaatgtcgacgccggcaagaagatcatccgcgagtccggcctcaacgtgctgccc
gccgacgatctcgacgatgccgcgcagaagatcgtcaaagccgtgaaagaggtcgcgtga

DBGET integrated database retrieval system