KEGG   Nitrobacter winogradskyi: Nwi_0423Help
Entry
Nwi_0423          CDS       T00276                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nwi_0423
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nwi_0423
  Amino acid metabolism
   00310 Lysine degradation
    Nwi_0423
Enzymes [BR:nwi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Nwi_0423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
476388..477662
Genome map
AA seq 424 aa AA seqDB search
MTEIRVPTLGESVTEATIGKWFKKQGDAVSVDEPLVELETDKVTIEVPAPSAGTLAELVA
RQGETVAVGALLGQITEGGAPAKPAAAKTQGISAESTTGRPDLKSDTTTPINAGPEEPRP
RAEADAPLAPSVRKLSAESGIDASTVSGSGKDGRVTKGDMLAAIEKAASAPTPVDQPAAA
VQVRAPSPADDASREERVKMTRLRQTIARRLKDVQNTAAILTTFNEVDMSGVMALRAHYK
DVFEKKHGVKLGFMGFFTKAIVQALRDIPAVNAEIDGSDLIYKNYYHIGIAVGTDKGLVV
PVVRDCDQKSIAEIEKSVADYGRRARDGQLKIEEMQGGTFTITNGGIYGSLMSTPILNAP
QAGILGMHKIQERPVAIGGKVEIRPMMYLALSYDHRVIDGKEAVTFLVRVKESLEDPARL
VLDL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatacgggttccgacgctcggcgaatcggtgaccgaggcgaccatcggaaaa
tggttcaagaaacaaggcgacgccgtatccgtcgacgagccgctcgtcgaactcgaaacc
gacaaggtaaccatcgaagtgcccgcgccgtccgccggcacgctcgccgaactcgtcgcc
aggcagggcgagacggtggccgtcggcgcgctgctcggacagatcaccgaaggcggcgcg
ccggcaaagccagcggcggccaagacgcaagggatcagtgccgaaagcacgaccgggcgg
ccggaccttaagtccgacaccacgacaccgatcaacgctggcccggaagaaccgcggccg
agagcggaagccgacgcgccgctagcgccctcggtgcgcaaactctccgctgagagcggc
atcgacgcttccaccgtgtcgggctccggcaaggatggccgcgtcaccaagggcgatatg
ctggcggcgatcgagaaggctgcgtcggcgccgaccccggtcgaccagccggctgccgcc
gtgcaggtgcgcgcgccttctccggcggacgacgcctcgcgcgaggagcgcgtgaagatg
acgcggctgcgccagaccatcgcgcgccgcctcaaggatgtgcagaacaccgccgcgatt
ctgacgaccttcaacgaagtcgatatgagcggcgtcatggcgcttcgcgcgcattacaag
gacgtgttcgagaagaagcatggcgtgaagctcggcttcatgggcttcttcaccaaggcc
atcgtgcaggcgttgagggacattccggcggtcaatgccgaaatcgacggcagcgacctg
atctacaagaactactatcacatcggaatcgccgtcggcaccgacaagggactggtggtg
cccgtggtgcgcgactgcgatcaaaaatcgatcgccgagatcgagaagagcgtcgccgac
tacggccgccgcgcccgcgacggtcagctcaagatagaggaaatgcagggcggcaccttc
accatcaccaacggcggcatctacggctcgctgatgtcgacgccgatcctgaatgcgccg
caggccggcattctcggcatgcacaagattcaggaacggccggtggcgatcggcggcaag
gtggaaatccggccgatgatgtatctcgctctctcttatgatcaccgcgtcatcgacggc
aaggaggccgtcaccttccttgtgcgcgtcaaggaatcgctcgaagatccggcacggctg
gtgctggatctgtaa

DBGET integrated database retrieval system