KEGG   Nitrobacter winogradskyi: Nwi_0443Help
Entry
Nwi_0443          CDS       T00276                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Nwi_0443
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Nwi_0443
Enzymes [BR:nwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Nwi_0443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
499266..500405
Genome map
AA seq 379 aa AA seqDB search
MTRPHLKKFRRIVVKVGSSLLIDSAAGKVRGEWLSALAADIAGLHGDGCDVLVVSSGAVA
LGRSKLKLPRGPLKLEESQAAAAVGQIALARIWSKVLADHGIGAGQILVTWQDTEERRRY
LNARSTIAKLLEWRAVPVINENDTVATNEIRYGDNDRLAARVATMASADLLILLSDIDGL
YDAPPHLNPDAKLITVVKRVTADIEAMAGSAASELSRGGMRTKIEAAKIATTAGTHMLIA
SGTIEHPLRAIMDGGPCTWFLTPANPVTARKRWIAGSLEPRGTLAIDAGAVAALRAGKSL
LPAGVTRIDGHFARGDAVIVRGPNGHEIGRGLVAYDAADADRIKGRSSSDAAQLLGVRGR
VEMIHRDDLVVGGPLGDSA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtccgcatctcaagaaatttcgtcgtatcgtcgtcaaggtcggctcgtcgctg
ctgatcgattccgcggcgggcaaggtgcggggggagtggctgtcggcgctggccgccgat
atcgcagggcttcacggcgacggctgcgacgtgctggtggtctcgtccggcgcggtcgcg
ctcggccgcagcaagctcaaattgcctcgcggtccgctgaagctggaggagagtcaggcg
gccgccgccgtcggacagatcgcgctggcccggatatggtcgaaggtgctggccgatcac
ggcatcggcgcggggcagatcctggtgacatggcaggacaccgaggagcgccgccgctat
ctcaatgcgcgctcgaccatcgcgaagctgctcgaatggcgcgcggtcccggtcatcaac
gaaaacgatacggtcgccaccaacgaaatccgctacggcgacaatgaccgccttgccgcg
agggtcgccaccatggcgagcgcggatctgctgattctgctgtccgacatcgacgggctc
tatgacgcgccgcctcatctcaacccggatgcaaaactgattacggtggtgaaaagggtc
acggcggacatcgaggcgatggccggcagcgccgcatccgagctgtcgcgcggtggaatg
cggaccaagatcgaggcagcgaagatcgcaacgaccgccggcacgcacatgctgatcgct
tcaggcacgatcgagcatccgctgcgggccatcatggatggaggtccctgcacatggttt
ctgacgccggccaatccggtcacggcgcgcaagcgttggatcgccggttcgctggagccc
agggggacgctcgcgatcgatgccggcgcggtggcggcgctgcgcgccggcaagagcctg
cttccggcgggcgtgacccggattgacgggcatttcgcgcggggcgatgccgtcatcgtg
cgcggtccgaacgggcatgagatcggccgcggcctcgtcgcctacgacgccgccgacgcc
gacaggatcaaggggcgttcgtcttccgatgccgcgcagcttctgggggttcgcggccgc
gtcgaaatgattcatcgcgacgacctcgtggtcggcgggccactcggcgattccgcttag

DBGET integrated database retrieval system