KEGG   Nitrobacter winogradskyi: Nwi_0523Help
Entry
Nwi_0523          CDS       T00276                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nwi_0523
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Nwi_0523
Enzymes [BR:nwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Nwi_0523
Two-component system [BR:nwi02022]
 CheA family
  CheA-CheYBV
   Nwi_0523
Bacterial motility proteins [BR:nwi02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Nwi_0523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
580784..582061
Genome map
AA seq 425 aa AA seqDB search
MGMSTAVASPVALDSGKLEPLRVMVVDDSVVIRGLISRWIEAEPDMMVAASLRTGRDAVS
QVERADPDVVVLDIEMPELDGISALPQLLAKKRNLIVIMASTLTRRNAEISFKALSLGAS
DYIPKPESTREVAAADIFRHDLMQKIRHLAAKRRRPATVASPPPDHDDYGSNASTIMNAV
DSNISERDAGGKPRRTFPHPALVQREQQPRSAQAARAMSRPQPTLRSFSAHLPRALLIGS
STGGPQALMTLVAGIGPVIDRCPVLITQHMPPTFTTILAEHLARAAGRPAHEGVDQEIVK
QGHIYLAPGGRHMRVARKGADAVIVLDNGPAVNFCKPAVDPLFMSAIDVWQGGALAVILT
GMGSDGMRGGTQIVAAGGSIIAQDEASSVVWGMPGAAVQAGICAAVLPLQQIAPKLVRLF
AGDGL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgagtactgcggtggcaagtccggtggctctggattcgggaaagctggagccg
ctacgggtcatggtggtcgatgattccgtcgttatccgcgggctgatttccagatggatc
gaggccgagcccgacatgatggtcgcggcctcgcttcgcaccggccgcgacgccgtcagc
caggtcgagcgcgccgatccggacgtcgtggtcctcgacatcgaaatgcccgaactcgac
ggcatttccgcgctgccgcaactgctggccaaaaagcgcaacctcatcgtcatcatggcc
tcgacgctgacccgccgcaacgcggagatcagtttcaaggcgctgtcgctcggcgcgtcc
gattacattccgaagcccgagagcacgcgcgaggtcgccgcggctgatatcttcaggcat
gacctgatgcagaagatccggcatctcgccgcgaaacgccgtcgtccggcgacagtcgct
tcgccgccgccagatcacgatgattatggatcgaacgcatccacaatcatgaacgcggtc
gattccaatatttcagagcgggatgcgggcggaaaaccgcgacgcacttttcctcatccc
gctctggtccagcgcgaacagcaaccgcgttctgctcaagccgctcgcgcgatgagccgg
ccccagccaacgctgcgttccttcagcgcgcacctcccgcgtgcgctgctgatcggttcg
tccacgggcgggccgcaggcgctgatgacgctggtggccggaataggaccggtgatcgac
cgctgtccggtgctgatcacccagcacatgcccccgacgttcaccaccattctcgccgag
catctggcgcgggccgcggggcgtccggcgcatgagggcgtggatcaggagatcgtgaag
cagggccatatctatctcgcgcccggcggccgtcacatgcgggtggcgagaaaaggagca
gacgcggtcatcgttctggataacggcccggcggtgaatttctgcaagccggccgtcgat
cctttgttcatgtcggcgatcgacgtctggcagggcggcgctctggccgtgatcctgacc
ggaatggggtcggacggaatgcgtggaggcacgcagattgtcgccgcgggcggcagcatc
atcgcccaggacgaagcaagcagcgtggtgtgggggatgccgggcgccgccgttcaggcg
ggaatttgcgcggccgttctgccgcttcaacaaattgctccgaagctggttcggctattc
gcgggagacggtttgtga

DBGET integrated database retrieval system