KEGG   Nitrobacter winogradskyi: Nwi_0943Help
Entry
Nwi_0943          CDS       T00276                                 

Definition
(GenBank) di-heme cytochrome c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
nwi  Nitrobacter winogradskyi
Brite
Enzymes [BR:nwi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Nwi_0943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3 DUF1924 Cytochrom_C550 DHOR Multi-haem_cyto
Motif
Other DBs
NCBI-ProteinID: ABA04205
JGI: Nwi0943
UniProt: Q3SU36
Position
1034534..1035460
Genome map
AA seq 308 aa AA seqDB search
MGEASTWRWTLPAGVSAPPVPADNPMTAAKVELGRRLFYDADLSVDGTMSCATCHVQKHA
FADSTRTRPGVTDEPGRRNVPGLANVAWFTPLNFADPAATTLEMQAATPVFGTHPVEMGM
AGREAEIGRRFGRDSCYQTMFARAFPEDGGRIDFSNVARALASFERTLISHGSAWDRQRL
GPEAQAGSALFARDCASCHSGSNFTDLTMHRLGPADPALADQGLFEKTGIDADRGKFRTP
SLRNIALTGPWWHDGSAWTLDEAIARHGLTHGAADVAQLIAFLGALSDTEFTQRKSLAMP
EDACGKRL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagcctcgacatggcggtggacgctgccggccggcgtttcggctccgcctgtt
ccggccgacaatcccatgaccgccgccaaggtcgagctcgggaggcgtctgttctacgac
gccgatctgtcggttgacggcaccatgtcctgcgccacctgccacgtgcagaagcacgct
ttcgccgatagcacccgaacccgtcccggcgtgacggatgagccggggcgacgcaacgtt
cccggtctggcaaatgtcgcatggttcacgccgctgaacttcgcggacccggcagcgacg
acgcttgagatgcaggcggcgaccccggtattcggcactcatccggtcgagatgggcatg
gcggggcgtgaagccgagatcggcaggcggttcggacgcgatagttgctaccagacgatg
ttcgcccgcgcctttcccgaagatggcggtcgcatcgacttttccaatgtggcgcgcgca
ctggcgagcttcgaacgcacgctgatctcccatggcagcgcctgggaccggcagcggctt
ggtcccgaagcacaagctggttccgcgctgttcgcccgcgattgcgcgagctgtcattca
gggtcgaacttcacggatttgaccatgcaccgtctcggcccggccgatcccgcgctggcc
gatcaggggctgttcgaaaagacggggatcgatgccgatcgcggcaagtttcgtacgccc
tcgctgcgcaacatcgcgctgaccggcccctggtggcacgatggatcggcgtggacgctc
gatgaggctatcgccaggcacgggctgacgcacggcgcggccgatgtggcgcagctgatc
gctttccttggggctctatctgacaccgagttcacccagcgcaaatcgctcgccatgcct
gaagatgcctgcggcaagcgcctgtga

DBGET integrated database retrieval system