KEGG   Nitrobacter winogradskyi: Nwi_0943Help
Entry
Nwi_0943          CDS       T00276                                 

Definition
di-heme cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
nwi  Nitrobacter winogradskyi
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1034534..1035460
Genome map
AA seq 308 aa AA seqDB search
MGEASTWRWTLPAGVSAPPVPADNPMTAAKVELGRRLFYDADLSVDGTMSCATCHVQKHA
FADSTRTRPGVTDEPGRRNVPGLANVAWFTPLNFADPAATTLEMQAATPVFGTHPVEMGM
AGREAEIGRRFGRDSCYQTMFARAFPEDGGRIDFSNVARALASFERTLISHGSAWDRQRL
GPEAQAGSALFARDCASCHSGSNFTDLTMHRLGPADPALADQGLFEKTGIDADRGKFRTP
SLRNIALTGPWWHDGSAWTLDEAIARHGLTHGAADVAQLIAFLGALSDTEFTQRKSLAMP
EDACGKRL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagcctcgacatggcggtggacgctgccggccggcgtttcggctccgcctgtt
ccggccgacaatcccatgaccgccgccaaggtcgagctcgggaggcgtctgttctacgac
gccgatctgtcggttgacggcaccatgtcctgcgccacctgccacgtgcagaagcacgct
ttcgccgatagcacccgaacccgtcccggcgtgacggatgagccggggcgacgcaacgtt
cccggtctggcaaatgtcgcatggttcacgccgctgaacttcgcggacccggcagcgacg
acgcttgagatgcaggcggcgaccccggtattcggcactcatccggtcgagatgggcatg
gcggggcgtgaagccgagatcggcaggcggttcggacgcgatagttgctaccagacgatg
ttcgcccgcgcctttcccgaagatggcggtcgcatcgacttttccaatgtggcgcgcgca
ctggcgagcttcgaacgcacgctgatctcccatggcagcgcctgggaccggcagcggctt
ggtcccgaagcacaagctggttccgcgctgttcgcccgcgattgcgcgagctgtcattca
gggtcgaacttcacggatttgaccatgcaccgtctcggcccggccgatcccgcgctggcc
gatcaggggctgttcgaaaagacggggatcgatgccgatcgcggcaagtttcgtacgccc
tcgctgcgcaacatcgcgctgaccggcccctggtggcacgatggatcggcgtggacgctc
gatgaggctatcgccaggcacgggctgacgcacggcgcggccgatgtggcgcagctgatc
gctttccttggggctctatctgacaccgagttcacccagcgcaaatcgctcgccatgcct
gaagatgcctgcggcaagcgcctgtga

DBGET integrated database retrieval system