KEGG   Nitrobacter winogradskyi: Nwi_0968Help
Entry
Nwi_0968          CDS       T00276                                 

Definition
tyrosinase (EC:1.10.3.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Nwi_0968
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Nwi_0968
Enzymes [BR:nwi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Nwi_0968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1064910..1066454)
Genome map
AA seq 514 aa AA seqDB search
MTTTRRTVLLQGGAIGAGLIAANVSAVRALAATKTTPVRRSLQGLAWNDPIVATYRDAVG
IMKQKPANDKFNWVQLANFHGNISTGFRYCPHGDWYFLPWHRAYTAMYERIVRSLTKNQD
FAMPYWDWTASPTMPEVFLPEKTPDGKTNWLCVNEDGRKRTWPPTQPMPANIVGPAVLST
ILNASPYEVFGTSRPAGQNSLDPSWITGGGGVQGTLEATPHNQVHNNIGGWMPTAASPRD
PIFFMHHGNIDRIWALWNLKHQNSTDPLWTDMPFKENFLNPDGSFWSPKVSDLYVPEKLG
YSYGFTQTPVVASSARTMTLERSLNAVLGAKAASKVEAGKVETAVVENNKSATPGAALAL
KIEVPQAALQGVVRSAPVGSGFDTMDFAAAREASARGSRALAIIRNVAITDPSTTTMQIY
LGDEPVPADASPSDRRYVGSFAMLDHGGGGHGAHGDHERPSFVLDLTDALQKVYGSAGTI
PGAIGLQLVVSNETGSGKAGSATPQRVEVVLVSG
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgacacgacggacggttcttctgcagggaggagcgatcggcgccggcctcatc
gccgcgaacgtatccgcggtgcgtgcgcttgcggcgacgaagacgactcctgtccgtcgt
tcattgcaggggcttgcctggaacgatcccatcgtcgcgacttatcgcgatgcggtcggc
atcatgaaacagaagcccgccaatgataagttcaactgggtgcaactcgcgaattttcac
ggcaacatcagcacaggcttccgctattgcccgcatggcgactggtacttcctgccgtgg
caccgcgcctataccgcgatgtacgaacgtatcgttcggagcctgacgaagaatcaggac
ttcgccatgccctactgggactggacggcgagcccgacaatgcccgaggtgttcctgccg
gagaagaccccggacggaaagaccaactggctgtgcgtgaatgaggacggcaggaaacgg
acgtggccgccgacacagccgatgccggcgaacatcgtggggcccgcggttctcagtacg
attctcaacgcgtcaccttacgaggttttcgggaccagccgccccgcgggccagaactcg
ctcgatccttcctggatcaccggcggaggcggcgtgcaaggcacgctcgaagcgacgccg
cacaaccaggtccacaacaacatcggtggctggatgccgaccgccgcatcgccgcgcgac
ccgatattcttcatgcaccacggcaatatcgaccgcatctgggcgctgtggaatctcaag
catcagaacagcacagatccgctctggaccgacatgccgttcaaggaaaacttcctcaat
ccggacgggtcgttctggtctcccaaagtgtccgacctctatgtgcccgaaaagcttggt
tacagctatggcttcacgcagactccggtcgtcgccagcagcgcccgaacaatgaccctg
gagcgctcgctcaacgccgttctcggcgcgaaggctgcctctaaagttgaggccggcaag
gtcgaaaccgcggtggttgaaaacaacaagagcgcgacgcccggcgccgcgctggctctc
aaaatcgaggtgccgcaggcggccttgcagggcgtcgtgcggagcgcgcccgtgggctcc
ggattcgacaccatggactttgctgcggcccgcgaggcgtcggcgcgcggaagccgcgct
ctggccattatccggaatgtcgccatcaccgatccgagcacgacgacgatgcagatttat
ctgggcgatgagcctgttccagccgacgcctcaccctcggatcgccgctacgtgggtagt
ttcgccatgctcgatcacggtggcggcggccatggtgcgcacggcgaccacgaacgtcca
tctttcgtcctcgatcttaccgatgcccttcagaaggtttacggttcagccggaaccatt
ccaggcgccatcgggttgcaactcgtcgtgagcaatgagaccggtagcggcaaggcgggc
agcgcgacgccgcagcgcgtcgaggtcgttctcgtttcagggtag

DBGET integrated database retrieval system