KEGG   Nitrobacter winogradskyi: Nwi_1025Help
Entry
Nwi_1025          CDS       T00276                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nwi_1025
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nwi_1025
   00052 Galactose metabolism
    Nwi_1025
   00500 Starch and sucrose metabolism
    Nwi_1025
   00520 Amino sugar and nucleotide sugar metabolism
    Nwi_1025
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Nwi_1025
   00524 Butirosin and neomycin biosynthesis
    Nwi_1025
Enzymes [BR:nwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Nwi_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1121750..1122727
Genome map
AA seq 325 aa AA seqDB search
MADPEMADSISRILLGDIGGTNARFALATDEHMGPIEKLRVTDYPDFDGALAAFLGRHRG
DLPITGAVLAVAGAVEANRSVLTNSGWVIDAGRLEKSFDLSAVRVVNDFKALAWSLPYLT
PPDLFAIGGGERASAAPAVVLGPGTGLGLACFVPRPRDPLAVTTEAGHVTLPGADAREDA
VIAHLRERFGHVSVERALSGSGLVNLYQSLAALDHLVVPPRKPSEITEAALRGSCPTSRE
AVDMFCAMLGTVAGNAALTFGARGGVYIGGGIAPRIREYLACSPFRTRFEAKGRFQAYVA
AIPSWVITHPDPAFVGLQRLARLES
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcctgaaatggctgattctataagtcgcatattgctgggagatatcggcggg
accaatgcccggtttgcgctcgctacggatgagcacatggggccgatcgaaaaattgagg
gtcaccgattatccggatttcgacggggcgctggccgctttcctcggccgtcaccggggc
gatctgccgatcaccggcgcggtgctcgccgtcgccggcgccgtggaagcgaatcgcagc
gtgctgaccaacagcggctgggttatcgatgccggacgattggaaaagagtttcgattta
tcggccgtgcgtgtcgtcaacgacttcaaggcgctcgcctggtcgctgccctacctcacg
ccgcctgacctgtttgcgatcggaggaggcgagcgcgcctctgcggcgcccgcagtggtg
ttggggcctggaacaggtctcgggctcgcctgctttgtgccgcgtccccgcgatccgctg
gccgtcaccacggaggcaggccatgtcacgcttccgggcgccgatgcgcgggaggatgca
gtgatcgcgcatttacgtgaacgcttcggccatgtctcggtggagcgcgcgctgtccggg
tcggggcttgtcaatctctatcagtcgctcgccgccctcgatcatcttgtcgtgcctccg
cgcaaaccaagcgagatcaccgaggcggcgcttcgtgggagttgtccgacgagccgggag
gctgttgacatgttctgcgccatgctgggcacggttgctggaaatgccgcgctgacgttc
ggtgcgcgtggcggcgtgtatatcggcggcggcatcgccccgcggatcagggagtatctg
gcgtgctcgccatttcgcacgcggttcgaagcgaaggggcgtttccaggcgtacgttgcg
gccatcccgtcctgggtgattactcaccctgaccctgctttcgttggattgcagcgtctc
gcgagactagaatcctag

DBGET integrated database retrieval system