KEGG   Nitrobacter winogradskyi: Nwi_1046Help
Entry
Nwi_1046          CDS       T00276                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:nwi00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:nwi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1139459..1140916
Genome map
AA seq 485 aa AA seqDB search
MKLRELFGDDATMDAPAGELAVTGLAADSRAVKPGDLFFALAGSKTDGARFIDAAIASGA
VAVAGDHAPARGRVPFIATPNPRRALALAAAKFYPRQPATIAAVTGTSGKTSVAAFTRQI
WQRLGYLSASIGTVGVVAPSRAVYGSVTTPDPIELHRELDQLAGEGVTHLALEASSHGLD
QYRVDGVRVRAAGFTNLSRDHMDYHPTVAHYLETKLRLFRDLVESDGIAVICADHDCSDT
VIEAAGARNVPVMRVGRRGDGARMGIRLVEAAIDGFAQRVTLEHAGRERVIRLPLVGEFQ
IENALVSAGLVIGTGGDVDQAFAALEHLEGARGRIERIGERNGAQVFVDYAHKPDALAKA
LQALRPYAKRKLVVVFGAGGDRDAGKRPLMGAIAADNADVVIVTDDNPRSEDPAAIRAAI
LAAAPGAREIGDRAEAIGTAIAGLQSGDALLIAGKGHETGQIVGDRVLPFSDHEAASAAL
TSRRI
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcgcgagcttttcggcgacgacgccaccatggacgcgccggccggcgagctt
gccgtcacgggtctcgcggcggatagccgcgcggtgaagcccggagatctctttttcgcg
cttgccggctcgaaaacggatggcgcgcggttcatcgacgccgcgatcgcgtcgggcgct
gtcgcggtcgccggtgatcatgcgcctgcgcgcgggcgcgtcccgttcatcgcaacgccg
aatccgcggcgcgcgctggcgctggcggcggcaaaattctatccgcgacagcccgcaacc
attgccgccgtgaccgggaccagcggcaaaacctcggtcgcggccttcacccggcagatc
tggcagcggctcggatatttgtccgcgagcatcggcaccgtcggcgtggtcgcgccctcg
cgcgcggtctacggctcggtgacgacgcccgatccgatcgagttgcatcgggagctggat
cagctcgcgggcgaaggcgtcacgcatcttgcgctggaagcatcctcgcacggtcttgat
caatatcgggtcgatggcgtgcgggtgcgcgccgccggcttcaccaacctgtcgcgcgat
catatggattatcatccgacggtcgcgcattatctcgagaccaagctgcggctgttccgc
gatctggtcgaatcggacggcatcgcggtgatctgcgccgatcatgactgctccgatacc
gtgatcgaagcggcgggcgcgcgcaacgtgccggtgatgcgtgtcggccgccgtggcgac
ggcgcgcggatgggcattcgcctggtcgaggcggcgatcgatggttttgcgcaacgggtc
acgctcgaacacgcagggcgcgagcgtgtcatccgcctgcctctggtcggagaattccag
atcgagaatgcgctggtgtcggccggtctcgtcatcggcaccggtggcgacgtcgatcag
gcgttcgcggcgctcgagcatctcgaaggcgccagggggcggatcgaacggatcggtgag
cgcaacggcgctcaggtctttgttgactacgctcacaaaccggacgcgctggcgaaggcg
ttgcaggcgttgaggccctatgccaagcgcaagctcgtggtggtgttcggagcaggcggt
gatcgcgatgcaggcaagcgcccgctgatgggagcgatcgccgctgataacgcggatgtg
gtgatcgtgaccgacgataatccgcgcagtgaagatcccgccgcgatccgcgccgcgatc
ctggccgccgctccgggtgcccgcgagatcggcgatcgcgccgaggcgatcgggaccgcg
atcgcgggattgcagtcgggagacgccttgctgatcgcgggcaagggtcacgagaccgga
cagatcgtcggcgatcgcgtgctgccgttcagcgatcacgaggccgccagcgcggcgctg
acgtcgaggcggatatga

DBGET integrated database retrieval system