KEGG   Nitrobacter winogradskyi: Nwi_1210Help
Entry
Nwi_1210          CDS       T00276                                 

Definition
glycoside hydrolase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Nwi_1210
Enzymes [BR:nwi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Nwi_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1328903..1330894
Genome map
AA seq 663 aa AA seqDB search
MPSGSGSGMTIHSKAQDLGINLDFVDGLGRHHLLDDVRLRPIVDGLPSPPHHRFLKHPVV
IVTNADDFSVPVGAEANGVFWRLVEGHTVLAQGYISSARIDLPRWISVGTYRLELESEKG
GILDSVPVLVTPERAYQGSFERVWILSVQLYALTSSRNWGIGDFTDLVSLIELTSDWGCH
GIGLNPLHALFDDRPLECSPYAPNSRLFLNPLYVDPERVPNCSRVWLKRQREQLDRVREG
ELVDYAAVAELKFAAFRHAFSRFRRDHAAQAEFDLFREERGQLLKRYACFEVLRRQFGPS
PWWSWPDEWRRPTDAGIQAISSGSRREEVKFVEFMQWCAASQLQSCADLAAERGMTVGLY
LDVAVGVQAGGFDAWNEQTSISRALSVGAPPDQLNTAGQDWGLAGFNAAGLEASDFAPFR
EMLRASMRFAGAIRLDHVFGLSRLYLIPAGGSPLQGAYVKMPLQALLGVIAQESVSQRCI
IIGEDLGTVPDGFREKLADWGVWSYKVMMFERGNDGAFIEASKYAENALVTFTTHDLASF
AGWQTHSDLRVKRELGIEPGETDAERTDARHAFEWKLGEEHIAVKNFIGAVEFLARTPSR
ILAIALDDLIELRDQPNIPGTLNEHPNWRRRTPVRLEDLGGCIDLDALRHALRGRCNSVH
DNP
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgccctcaggttcagggtcggggatgactatccattcaaaagcgcaagatctgggcatc
aacctggactttgttgacggactcggccgccaccatctcctggatgatgttcggttgcgt
cccattgttgatggtctaccatcgcctccgcaccatcgtttcctaaaacatcccgtggtc
atcgttaccaatgcggacgattttagcgtgccggtcggagcagaggcgaacggcgttttc
tggcggctcgtggaaggtcacacggtgctcgcccaaggatacatttcttcggcaaggata
gatctcccgcgctggatatcggtcggcacttatcggctggaactcgaaagcgagaagggc
ggcattctcgattcggttccggttctggtcacgcccgaaagggcctatcaaggctcattc
gagcgcgtatggatcctgtccgttcaactgtacgcgctgacatcgtcgcgcaactggggc
attggtgacttcacagatctggtatcgctgatcgaactcacctcggattggggctgccat
ggcatcggtctcaatccgctccatgctctgttcgatgatcgtccactagaatgcagtccc
tatgcgccgaatagccgcctgtttctcaatccgctttatgtcgatcccgagcgggtgccg
aattgttcgcgcgtgtggctaaaacgacagcgtgaacaactcgatcgggtccgggagggc
gaactcgtcgattacgcggccgtcgccgaactgaaattcgcagcgttccggcatgcgttt
tcgaggtttcgacgtgatcacgcggcgcaggccgagttcgacctcttcagggaggagaga
ggccaactgttgaaacgatatgcctgcttcgaggtgttgcggcgccagtttggtccatcg
ccctggtggtcgtggcccgacgagtggcgccgtccgactgacgccgggattcaagccata
tccagcggctcacggcgcgaggaagtgaagttcgtcgagttcatgcaatggtgcgcagcg
tcccaactacagtcatgcgccgatcttgccgccgaacggggcatgacggtcgggctctat
ctggatgtcgccgtcggtgtgcaggccggcggattcgacgcctggaatgagcagacctcc
atttcgcgcgcgctgtcggttggggcgccgcctgatcaactcaacacggcggggcaggat
tggggattggcgggattcaatgccgctggcctagaggcgagcgacttcgcaccgtttcga
gagatgctgcgcgcttccatgcgtttcgccggagccatacggttggatcatgtgttcggt
ctcagccgcctctacctgataccggccggcggatcgcctttgcagggagcatatgtaaag
atgccgctgcaggccctgctcggcgttatcgcgcaagagagcgtcagccagcgttgcatc
atcatcggcgaggatctcggaacggtaccggatggctttcgtgaaaaactcgctgattgg
ggtgtgtggtcctacaaagtgatgatgtttgaacgcggcaacgatggtgctttcatcgaa
gcgtcaaaatatgccgagaacgcgctcgttactttcacgacgcatgaccttgcatccttc
gccggctggcaaacgcattctgacctcagggtcaaacgcgagcttgggatcgagcccggc
gaaacggatgcggagcggacggatgcgcgccatgcattcgagtggaagctcggcgaagaa
cacatcgcagtgaagaattttatcggagccgtggagtttcttgcgcgaacgccgtcccgt
attctcgcgatcgcgctcgacgatttgatcgaactgcgggatcaaccgaatattccaggt
acgttgaatgagcatcccaactggcggagacggactccagtcaggttggaagatttaggc
ggatgcattgacctcgacgcgcttcgacacgcgctccgtggccgctgcaacagcgttcac
gataatccatga

DBGET integrated database retrieval system