KEGG   Nitrobacter winogradskyi: Nwi_1329Help
Entry
Nwi_1329          CDS       T00276                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Nwi_1329 (folE)
Enzymes [BR:nwi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Nwi_1329 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1458492..1459217
Genome map
AA seq 241 aa AA seqDB search
MDALIKPLRSGKPSDINKASDIKSSNAKPAGFSPAQLDPSEFMAAVQPNRQRPSRHEAED
AVRTLLAYIGENPDREGLLDTPRRVIESYDEIYQGYHQCPAEVLNRTFGETAGYDDFVLV
RDIQFTSQCEHHMMPFYGKAHIAYTPVERVVGLSKLARLTDIFARRLQTQEHMTAQIAAA
VDEVLKPRGVAVMIEAEHTCMSVRGVAKHGAMTVTSRFTGVFRDDPAEQARFLSMVRGQP
R
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggacgctttgatcaagccgctgcgcagcggcaagccttctgacatcaacaaggcttct
gatatcaaatccagtaacgccaagcctgccggcttttctcccgctcaactggacccgtcg
gagtttatggcggcggttcagccgaaccggcagcgcccgtcgaggcatgaagctgaagac
gcggtcagaacgttgctggcctatatcggcgaaaatcccgaccgggaggggctgctcgat
accccgcgccgggtgatcgaatcgtatgacgagatttatcaaggctatcatcagtgtccg
gccgaagtgttgaatcggaccttcggtgaaaccgccggctatgatgatttcgtgctggtg
cgcgacatccagttcacttcgcagtgcgagcatcacatgatgccgttctatggcaaagcg
catatcgcctatacgccggtggagcgggtggtcgggctgtccaagctggcgcgtctgacc
gacatcttcgcccggagactccagacccaggagcacatgaccgcgcagatcgccgcggcc
gtggacgaggtgctcaagccgcgcggcgtcgccgtgatgatcgaggccgagcatacctgc
atgtcggtgcgcggcgtcgccaagcatggcgcgatgaccgtcaccagccggttcaccggc
gtgttccgagacgatccggcggagcaggcgcgtttcctgtccatggtacgggggcagccg
cgttag

DBGET integrated database retrieval system