KEGG   Nitrobacter winogradskyi: Nwi_1495Help
Entry
Nwi_1495          CDS       T00276                                 

Definition
(GenBank) hypothetical protein
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1625528..1626124)
Genome map
AA seq 198 aa AA seqDB search
MTADVRLMSLLGALRNFNDYITASGRLSAESLANQIRIERILADKVMFNMGWYAAREIAG
DLKGAAATEAVLPLLFKAAELANSLADATERCEALDAKLAELNRPGRKKGSYEKWHFDPG
YSVVVAMIETRPEKRQSDHVRWAVKNGWLDKSIPDKTHIRRIGLIQRRQEAERAAQLASL
GANVIPFKSNRNPQKRAK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacggctgatgtgcggctaatgtcgcttttgggcgcattacgaaatttcaacgactac
atcaccgccagcggacgcctaagcgcggagtcactagcaaaccagattagaatagagcgc
attcttgctgacaaggtgatgttcaatatgggctggtacgccgcgagggagattgcaggc
gatcttaagggcgcggcagccaccgaggccgtgctcccattgctttttaaggctgccgag
ctggccaacagcctagctgatgcgactgagcgatgcgaggccctcgacgcgaaactagct
gagctaaaccggccgggccgcaagaaggggtcatatgagaaatggcactttgatccgggt
tattccgtagtcgtcgccatgattgagacgaggccggaaaagaggcagtcggatcatgtg
cgatgggccgtcaaaaatggatggctggacaaaagcattcccgacaagacgcacattcgc
aggattggactaatccagcggcgacaagaggctgaaagggcggcgcaactagcctcattg
ggtgccaacgtgatcccattcaaatccaatcggaatccacaaaaacgagccaaataa

DBGET integrated database retrieval system