KEGG   Nitrobacter winogradskyi: Nwi_1516Help
Entry
Nwi_1516          CDS       T00276                                 

Definition
(GenBank) Protein of unknown function DUF502
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF502
Motif
Other DBs
NCBI-ProteinID: ABA04777
JGI: Nwi1516
UniProt: Q3SSG4
Position
complement(1649391..1650164)
Genome map
AA seq 257 aa AA seqDB search
MTRDTPPSGAQGDHSPDMPRGLIARFRNYFLTGLIVAGPVAITLYLTWWFVNWVDNLVRP
FVPMAYRPETYLPFILPGSGLIVAVFALTMLGFLTANLIGRTLVDLGEKVLGRMPVVRAI
YRGLKQVFETLFSGSGSSLRRVGLVEFPSPGMWSIVLISQVPSANVAARLPSQEEHISVF
LPCAPNPTTGFFFYVPKNRVVEIDMSTEEAATLIMSAGVVQPNSDSQKKLAALAEMAQAA
RVANASNLASTTAAKVD
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtgacacccctccgagcggcgcacaaggcgaccattccccggacatgcctcgc
gggctcatcgcgcgattccggaattactttctgaccggcctgattgtcgcaggcccggtg
gcgataacgctttacctgacctggtggttcgtgaactgggtcgacaacctggtgcggccg
ttcgtcccgatggcatatcggccggaaacgtacctgcctttcatattgcccggatcgggc
ctgatcgtcgcggtgttcgcgctgaccatgctcggcttcctgacggccaacctgatcggc
cggacgctggtcgatcttggcgaaaaagtgctcggccgtatgccggtggtgcgggcgatc
taccgcggactcaagcaggtcttcgaaacgcttttctcgggatccggatcgagcctccgc
agggttggtctcgttgaattcccgtcgcccggcatgtggtcgatcgtgctcatctcgcag
gtgccaagcgcgaatgtcgctgcccggcttccctctcaggaggagcatatttccgtattc
ctgccctgcgcgcccaacccgaccacgggcttcttcttctacgtgcccaaaaacagggtc
gtcgagatcgacatgagcacggaggaggcggcgaccttgattatgtcggccggcgtggtt
cagccgaactccgattcgcagaagaagctcgcggccctcgcggaaatggcccaggcggcg
cgggtcgcgaatgcctccaacctcgcgtcgacaacggctgcgaaggttgactga

DBGET integrated database retrieval system