KEGG   Nitrobacter winogradskyi: Nwi_1532Help
Entry
Nwi_1532          CDS       T00276                                 

Definition
glycosyl transferase family protein (EC:2.4.1.83)
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1671991..1672740)
Genome map
AA seq 249 aa AA seqDB search
MSTRTTAPTVSIVVPVRNEADNVAPLIEEIAAALDGRWDYEIVYVDDGSTDATAERLTAI
MAERGTVRQIRHEKSSGQSAAVRTGVRAARGPIVATLDGDGQNNPEFLPELIMAIEKGEG
RIGLAAGQRVGRKDTGFKKFQSRVANKVRSRVLSDGTRDTGCGLKAFRREVFLSLPYFDG
LHRFLPALVRREGYDIAYVDVTDRPRRSGVSNYGFFDRLWIGIIDLAGVWWLIRRKKSTP
VATEVLRHD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccagaacgaccgcgcccacagtttccattgtcgtgcccgtgcgcaacgaggcg
gacaatgtcgcgcccctgatcgaggagatcgcggcggcgctcgacggccgatgggattac
gagatcgtctatgtcgacgacggctccactgacgcgaccgctgagcggttgacggcgatc
atggccgagcgcgggaccgtgcgccagatccgtcacgaaaagtcatcgggccaatcggcg
gcggttcgaaccggggtgcgggccgcacgcggtccgatcgtcgcgacgctggatggcgac
ggccagaacaatccggagtttctgcccgagctcatcatggcgatcgagaagggcgaggga
cgcattggtctcgccgccggccagcgcgtcggccgcaaggataccgggttcaagaagttc
cagtcgcgagtagccaataaggtgagaagccgggtgctgagcgatggaacgcgcgacacc
ggctgcgggctgaaagcctttcggcgcgaggtgtttctgtccttgccttatttcgacggc
ctgcaccggtttctccccgcgctggtgcggcgggaaggctatgacatcgcctatgtcgac
gtgaccgaccggccgcgacgttcgggcgtgtcgaattacggattcttcgatcgcctgtgg
atcggaatcatcgatcttgccggtgtgtggtggctgatccggcgcaagaaatcgacgcca
gttgcaaccgaggtgctgcgtcatgactga

DBGET integrated database retrieval system