KEGG   Nitrobacter winogradskyi: Nwi_1536Help
Entry
Nwi_1536          CDS       T00276                                 

Definition
(GenBank) hypothetical protein
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pinin_SDK_N
Motif
Other DBs
NCBI-ProteinID: ABA04797
JGI: Nwi1536
UniProt: Q3SSE4
Position
1683246..1683563
Genome map
AA seq 105 aa AA seqDB search
MPGRSDPVPERPAVPPTGGPFLRAPSALTNPSDLRSIDGAVGNLSGRYRSTAAPNRAAGH
VRLARAGRTTASHGDQRRHGQRDQDGTHHAPALGSTIVNPAIERG
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
ttgcccggcagatccgatcccgttcccgaaaggcccgctgtgcctccaaccggcgggcct
tttttgcgagcaccatcagcgctcacgaatccgtctgatctccgctcgatcgacggcgca
gttggcaacctctcgggtcgatatcggagcaccgccgccccgaaccgcgcagccggccat
gtccgcctcgctcgggccggacggaccacagccagccatggcgatcagcgccgccacggc
cagcgggatcaggatggcacgcatcacgcccctgccctcggatcgacaatcgtgaacccc
gcgatcgaacgcggatga

DBGET integrated database retrieval system