KEGG   Nitrobacter winogradskyi: Nwi_1554Help
Entry
Nwi_1554          CDS       T00276                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MT-A70 CHASE8
Motif
Other DBs
NCBI-ProteinID: ABA04815
JGI: Nwi1554
UniProt: Q3SSC6
Position
complement(1699313..1701565)
Genome map
AA seq 750 aa AA seqDB search
MTELVKYEEARRLLAEAVAVDEVKLIRDQAVALAAYARQAKDREIEVAAAQIRFRAEQRL
GEMIIAQKETVGLAKGGQPYRNPTCSDKEQVGTPVPTLEQAGIDRKLSSRAQRMARLPED
KFEELLERHADEVRSGVRVTMDLLKVGEEADGRERRRALQQALSDETARLPTGRRFPVIY
ADPPWHRKQGVTGRSYENHYPTMTWDDICALPVKDLLLPDAWVFLWIPRAHMFALHAVDM
EFATDDGCVITRKVQLPLAWAVARAWGCDSYSTAFVWTKTDEEHPEDQGGGVITFDQDEI
LLLFKRGRGLPKPDTKEKFGSNHRERSKPLGHSRKPEFYREMIATMCGGLPVMELFARVD
AEHPLPPKWEGWGNQTSPSSGDNEIAETVAPGSTADESTAGNATMLPVAAPTLSADDGLD
LPACLRRTKSEVPSGASDGGSENTSNLSVSGDADREQQRDTLGVTAGRDRQPTSPMSELV
EWKVLGAIDANVSISGPIDGLIESGLVDFDFDKLLFLTDEGKERFAVLEQKFNPAPESDS
FVGSADAVDEIADEVVGIADAVDVGEPEMAGASAGPLPSTPDSGPDEFTILKAFANSATR
DRFNIIGPVASDYIARGLVFKYDTITDWGLTAAGYDRLDELKRERAGLAPKVLTPPAVSD
LSDDEQEMREVLAAIAGAYRSDLSATRRATYERDLIGLGFLSVIDDCGGLAVTEAGHAWL
RETEAGSAPPPLTQPEPLTPVQINMFGAVR
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgaactcgtcaaatacgaggaggcgcgtcgacttttggctgaagccgtcgctgtc
gacgaagtgaagttgatccgggatcaagccgtcgcacttgcggcttatgcgcgccaagcc
aaagaccgcgagatagaagtcgctgcggcgcagatccgctttcgggcggagcagcgactc
ggcgagatgatcatcgcgcagaaggaaaccgttgggcttgccaaaggtggtcagccgtac
cgcaatcctacctgttccgacaaggaacaggtaggaacgccggtcccgacactcgagcag
gctggcatcgaccgcaaactgtcctcgcgtgcgcagcgcatggcgcggctgccggaagac
aagtttgaggaactgctcgagcgtcatgctgacgaggtgcgatccggcgtgcgcgtcaca
atggatctactgaaggtcggcgaagaggccgatggccgtgagcgtcgccgcgcgctgcag
caggcgctttcggatgaaaccgcaagactgccgaccggccgccggttcccggtgatctat
gcggatccaccctggcaccggaagcagggcgtcaccggccgctcttacgagaaccactat
cccaccatgacgtgggacgacatctgcgcgctgccggtcaaggatctgttgctgccggat
gcctgggtgtttctctggatcccgcgcgcgcacatgttcgcgctgcatgccgtcgatatg
gaattcgcgacggatgacggttgcgtcatcacccgcaaagtgcagctgccgttggcctgg
gccgtggcgcgcgcctggggctgcgacagctactcgaccgccttcgtctggaccaagacc
gacgaagagcacccggaagatcagggcggcggcgtcatcacctttgaccaggacgagatc
ctgctcctgttcaagcgcggccgcggtctgccgaagcccgacacgaaggaaaagttcggc
tccaaccatcgggagcgctcgaagccgctcggccattcccgcaagccggaattctatcgg
gagatgatcgccaccatgtgtggcgggctgccggtgatggaattgttcgcgcgcgtcgat
gccgagcacccgctgccgccgaagtgggaagggtggggaaaccagacaagtccatcgtcc
ggcgacaacgaaatcgcggagaccgtcgcgcccggaagtacggccgacgagtcaaccgcc
gggaacgcgacgatgttgcccgtcgcggctcccaccctttccgccgatgatgggctggat
cttccggcttgtctgcggcgtacgaaatctgaggtgccgtccggcgcgtcagacgggggc
agcgagaacacgtccaatctcagcgtgagcggagatgccgaccgcgagcaacagcgcgac
actttgggcgtgacagccgggagagaccggcaaccaacatcgccaatgtccgagttggtg
gaatggaaagttctcggcgcgatcgacgcgaacgtcagcatatctggcccgatcgatgga
ctgatcgaatccggccttgttgacttcgacttcgacaagcttctgtttctaactgacgaa
ggtaaagagcggttcgctgtccttgagcagaaattcaatcctgcgccggaatcagattcg
tttgtcggatcggccgatgcggttgacgaaatcgccgatgaggttgtcggtatcgccgat
gcggttgatgtcggcgagcctgaaatggccggggcgtcggcgggtccgttgccgtcgacg
cccgatagtgggcccgacgaattcaccatcctcaaggcgttcgcgaattccgcgacccgg
gaccggttcaatatcattggtcctgttgcttccgactacatcgcgcgcggattggtgttc
aaatacgacaccattacggattggggtctcactgccgccggctacgatcggctagatgag
ctgaagcgcgagcgcgccggccttgcgccgaaggtcctcacaccgccggcggtctctgat
ctttccgacgacgagcaggagatgcgcgaggtgctggcggcgattgccggcgcttatcgt
tccgatctgtcagcgacccggcgcgcgacctacgagcgcgacctgatcgggctcggattt
cttagcgtcatcgacgactgcggcggtctcgccgtcaccgaggccggacacgcctggctg
cgagagaccgaagccggcagcgcgccgccgccgctcacgcagccggagcctttgacgccg
gtgcagatcaacatgtttggggctgtgagatga

DBGET integrated database retrieval system