KEGG   Nitrobacter winogradskyi: Nwi_1575Help
Entry
Nwi_1575          CDS       T00276                                 

Definition
polyphosphate glucokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nwi_1575
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nwi_1575
   00520 Amino sugar and nucleotide sugar metabolism
    Nwi_1575
Enzymes [BR:nwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Nwi_1575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1722783..1723493)
Genome map
AA seq 236 aa AA seqDB search
MKAARSSRMNPTILAIDVGGSNVKMMTNTDRVPRKFESGPGLTAKEMVRKIKALTKDWSF
DVVSIGYPGPVCGNRPLREPVNLGVGWKGFDFQKAFGKPTRVVNDALMQALGGYRGGRML
FLGLGTGLGSAMIADGEPEPMELAHLPYRKGKTYEDYAGKAGRKHSGDKKWRKHVFDIIA
QLSAALEPDEVLIGGGNARHLEKLPPKSRRGDNADAFEGGFRLWDQSSVDARARVR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcacgctccagccggatgaacccgaccattctcgcgatcgacgtcggcggg
tccaatgtcaagatgatgaccaacacggaccgcgtcccgcgcaagttcgaatccggaccc
ggtctcacggcgaaagagatggtgcgcaagatcaaggcgctgacgaaggactggtccttc
gacgtcgtttcgatcggctatcccggcccggtctgcggaaatcgcccgctgcgcgaaccc
gtcaatctcggcgtggggtggaaaggattcgattttcagaaggcgttcggcaagccgacc
cgcgtcgtcaacgatgcgttgatgcaggcgctcggcggctatcgcggcgggcggatgctg
tttctcgggctcggcaccgggctcggctccgcgatgatcgcggacggcgaaccggagccg
atggaattggctcacctgccataccggaagggtaaaacctatgaggattacgccgggaag
gcggggcggaagcacagcggcgacaagaaatggcgcaagcatgtcttcgacatcatcgcg
cagctttcggccgcgctcgaaccggacgaggtgctgatcggcgggggtaacgccaggcat
ctcgaaaagctgccgccgaaatcgcggcgcggcgacaatgccgatgcgttcgagggcggt
ttccggttatgggatcagagcagtgtggacgcgcgggcgagggtgcgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system