KEGG   Nitrobacter winogradskyi: Nwi_1579Help
Entry
Nwi_1579          CDS       T00276                                 

Definition
(GenBank) conserved hypothetical protein
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2161 Mrr_N
Motif
Other DBs
NCBI-ProteinID: ABA04840
JGI: Nwi1579
UniProt: Q3SSA1
Position
1726254..1726931
Genome map
AA seq 225 aa AA seqDB search
METSLYLPVKRHLESLGFSVKGEVGGCDLVALNGDDPPVVVIGELKLSFNLELILQGVER
AGACDEVWLAARLSMRGKGRESDARYRNLCRRLGFGMLGVTHQGNVEVLVAPSAASPRRN
PKKRSRLVMEHQRRRGDPVAGGSTRMPIMTAYRQQALSCAAAMAAGPCRVRDLRGENPDA
GKILLHNVYGWFDRVDRGIYCLTEAGKDALKRWPQQSCEAVPIVE
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtggaaacctcgctttatcttccggtcaaacgccatcttgaaagccttggtttctcggtc
aaaggcgaagtcggaggctgcgacctggttgcgctgaacggcgatgatccgcctgtcgtg
gtgatcggcgaactgaagctgagcttcaatctggagcttatcctgcaaggcgtcgagcgc
gcgggcgcatgtgatgaggtctggcttgccgccaggctgtcgatgcgtggcaagggccgc
gagagcgacgcgcgctatcgcaacctgtgccggcggctcgggttcggaatgctcggggtg
acacaccaggggaatgtcgaagtgctggtggctccctccgctgccagtccgcgccgtaac
ccgaagaagcgttcccgccttgtcatggagcatcaacgccgcaggggcgatcccgttgcc
ggcggcagcacgcgaatgccgatcatgacagcgtatcgccagcaggcgctgagctgcgcg
gccgcgatggctgcgggtccatgccgcgtgcgggatctcagaggagagaatcccgatgct
ggaaaaatccttcttcacaatgtctatggatggttcgatcgcgtcgatcgtggaatttat
tgcctgaccgaggctggcaaggacgcgctgaagcgatggccgcagcagtcatgcgaagca
gtgccgatcgtcgaatga

DBGET integrated database retrieval system