KEGG   Nitrobacter winogradskyi: Nwi_1658Help
Entry
Nwi_1658          CDS       T00276                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
nwi  Nitrobacter winogradskyi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1804565..1805629
Genome map
AA seq 354 aa AA seqDB search
MVELNEHERTMAFAEVALGQIRSLRQAAVPRNYEVWYVYAAGYNCSLNRTINETLARNGT
LSDVDLEQIYDTYLSPIRTTERIDKVGARVINEIDEVILLITGARSMAAGFGDSLREAAR
QLGAAGSHAQIKSVIAALMTSTLDMQEANKVLEDRLELSKVEINNLQHSLEAIRAESMTD
PLTGLGNRKYFDRAVADAVALAMSEGEPLSLLMFDIDHFKSFNDNYGHLTGDQVLRLVAM
SLKQNIKGQDITARYGGEEFAVVLPSTALKQALTVADHIRRAVMAKELKKKSTGEILGRV
TISIGVSMLRPGDTPDSLMERADACLYAAKRGGRNRAICETDPEYFAGAETRVA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtggttgagctgaacgaacatgaacgcaccatggcgttcgccgaggtggcgctcggccag
atccgttcgctgcgtcaggccgcggtgccgcgcaattatgaagtctggtacgtctacgcc
gccggatataactgctccctcaacaggaccatcaacgagacgctggcgcgcaacggaacg
ctgagcgacgttgatctcgagcagatctacgatacctatctttctccgatcaggacgacc
gaacgcatcgacaaggttggcgcgcgggtgatcaacgaaatcgacgaggtgatacttctt
attaccggcgcgcgcagcatggcggccggttttggagacagcttgagagaagccgccagg
cagcttggcgccgccggcagtcatgcgcagatcaagtcggtcatcgcggcgttgatgaca
tcaaccctcgacatgcaggaagccaacaaggttctggaggaccggctggagctctcgaag
gtcgagatcaataaccttcagcatagtcttgaggccatcagagctgaaagtatgacggat
ccgctcaccggtctcggcaaccgaaagtatttcgatcgagccgtggccgacgccgtggcg
ctggcaatgagcgaaggcgagccgctgtcgcttctgatgttcgacatcgaccatttcaag
tcgttcaacgacaactacggacacctgaccggcgaccaagtcctgcggctggtcgcgatg
tcattgaagcagaacatcaaggggcaggacatcaccgctcgttacggcggtgaagaattc
gcggtcgtgctgccgagcaccgcgctgaaacaggcgctgacggtcgcggatcatatccgg
cgcgccgtgatggccaaggagctgaagaaaaaatcgaccggcgagatcctgggccgcgtc
accatctcgatcggcgtctcgatgcttcgccccggcgatactccggactcactgatggag
cgcgccgatgcctgcctgtacgcagccaagcgtggcggccgcaaccgcgctatttgcgag
accgatccggaatacttcgctggcgctgagactcgcgtggcatga

DBGET integrated database retrieval system