KEGG   Nitrobacter winogradskyi: Nwi_1658Help
Entry
Nwi_1658          CDS       T00276                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
nwi  Nitrobacter winogradskyi
Brite
Enzymes [BR:nwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Nwi_1658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1804565..1805629
Genome map
AA seq 354 aa AA seqDB search
MVELNEHERTMAFAEVALGQIRSLRQAAVPRNYEVWYVYAAGYNCSLNRTINETLARNGT
LSDVDLEQIYDTYLSPIRTTERIDKVGARVINEIDEVILLITGARSMAAGFGDSLREAAR
QLGAAGSHAQIKSVIAALMTSTLDMQEANKVLEDRLELSKVEINNLQHSLEAIRAESMTD
PLTGLGNRKYFDRAVADAVALAMSEGEPLSLLMFDIDHFKSFNDNYGHLTGDQVLRLVAM
SLKQNIKGQDITARYGGEEFAVVLPSTALKQALTVADHIRRAVMAKELKKKSTGEILGRV
TISIGVSMLRPGDTPDSLMERADACLYAAKRGGRNRAICETDPEYFAGAETRVA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtggttgagctgaacgaacatgaacgcaccatggcgttcgccgaggtggcgctcggccag
atccgttcgctgcgtcaggccgcggtgccgcgcaattatgaagtctggtacgtctacgcc
gccggatataactgctccctcaacaggaccatcaacgagacgctggcgcgcaacggaacg
ctgagcgacgttgatctcgagcagatctacgatacctatctttctccgatcaggacgacc
gaacgcatcgacaaggttggcgcgcgggtgatcaacgaaatcgacgaggtgatacttctt
attaccggcgcgcgcagcatggcggccggttttggagacagcttgagagaagccgccagg
cagcttggcgccgccggcagtcatgcgcagatcaagtcggtcatcgcggcgttgatgaca
tcaaccctcgacatgcaggaagccaacaaggttctggaggaccggctggagctctcgaag
gtcgagatcaataaccttcagcatagtcttgaggccatcagagctgaaagtatgacggat
ccgctcaccggtctcggcaaccgaaagtatttcgatcgagccgtggccgacgccgtggcg
ctggcaatgagcgaaggcgagccgctgtcgcttctgatgttcgacatcgaccatttcaag
tcgttcaacgacaactacggacacctgaccggcgaccaagtcctgcggctggtcgcgatg
tcattgaagcagaacatcaaggggcaggacatcaccgctcgttacggcggtgaagaattc
gcggtcgtgctgccgagcaccgcgctgaaacaggcgctgacggtcgcggatcatatccgg
cgcgccgtgatggccaaggagctgaagaaaaaatcgaccggcgagatcctgggccgcgtc
accatctcgatcggcgtctcgatgcttcgccccggcgatactccggactcactgatggag
cgcgccgatgcctgcctgtacgcagccaagcgtggcggccgcaaccgcgctatttgcgag
accgatccggaatacttcgctggcgctgagactcgcgtggcatga

DBGET integrated database retrieval system