KEGG   Nitrobacter winogradskyi: Nwi_1683Help
Entry
Nwi_1683          CDS       T00276                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00230  Purine metabolism
nwi01100  Metabolic pathways
Module
nwi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Nwi_1683
Enzymes [BR:nwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Nwi_1683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 cobW TsaE ABC_tran AAA_22 MMR_HSR1 AAA_16
Motif
Other DBs
NCBI-ProteinID: ABA04944
JGI: Nwi1683
UniProt: Q3SRZ7
Position
complement(1835935..1836594)
Genome map
AA seq 219 aa AA seqDB search
MTAHDRGFDGVERRGLMFVLSSPSGAGKTTLSRLLIERVEGLSLSVSATTRPMRPGEVDG
RDYAFVDEKTFAAMVERNDLLEWAHVFDNHYGTPRAPVDAALSSGRDVLFDIDWQGTQQL
REKARDDVVSVFILPPSAADLERRLHTRAQDSDDVIRERMARAAHEVSHWAEYDYIVINR
DIDEAFAEVQSILKAERLKRERRTGLTAFVRELQRQLET
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgactgctcacgatcggggtttcgatggagtcgagcggcgcggcctgatgttcgtgcta
tcgtcgccttccggcgccggcaagaccacgctgtcgcggctgctgatcgagcgcgtcgaa
ggcttgagcctgtcggtatccgcgaccacccgaccgatgcggcccggcgaggtcgatggt
cgtgactacgcgttcgtcgacgagaaaacctttgcggccatggtcgagcggaacgatctg
ctagaatgggctcatgtgttcgacaatcattacggcacgccgcgcgcgccggtggatgcg
gcgctgtcatccggccgcgatgtcctgttcgatatcgactggcaaggcacgcagcagcta
cgggagaaggcgcgagacgacgtggtcagcgtctttattctgccgccgtccgccgcggat
ctggagcggcgtctgcatacccgcgcccaggattcggatgatgtcatccgtgaacgaatg
gcccgcgccgcccatgaagtgagccactgggccgaatacgattacatcgtcatcaaccgg
gatatcgatgaagcgttcgccgaggtgcagtctatcctgaaggctgagcggctcaagcgc
gaacgccggaccggattgaccgctttcgtacgagaactacagcggcaactcgaaacttag

DBGET integrated database retrieval system