KEGG   Nitrobacter winogradskyi: Nwi_1805Help
Entry
Nwi_1805          CDS       T00276                                 

Definition
(GenBank) glycoside hydrolase, family 3
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00520  Amino sugar and nucleotide sugar metabolism
nwi01100  Metabolic pathways
nwi01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Nwi_1805
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Nwi_1805
Enzymes [BR:nwi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Nwi_1805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ABA05066
JGI: Nwi1805
UniProt: Q3SRM5
Position
complement(1977594..1978610)
Genome map
AA seq 338 aa AA seqDB search
MSTRAFITGASGLGLTMQEREFLRAGRPWGFILFKRNIDNPLQVARLVQEFREAIEDGDA
PVLIDQEGGRVQRLGPPHWPVYPAGATFGALYDRDQAAGLEAARLGAQLIAADLADLGIT
VDCLPLADVPVPGADAVIGDRAYGTDPLKVATIARAVTEGLEQGGVLPVLKHIPGHGRAT
ADTHHRLPIVDTLKDELEAVDFAAFRPLSDLPMAMTAHVVFSAIDATQPATTSATIIEQV
IRGSIGFQGLLMSDDVSMNALTGSIAQRTRAIVAAGCDMVLHCNGQLDEMRQVASEAPEL
SGVALDRARRALAARRPPQPFDREAARAKLDALTAASA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcgcgcattcatcacgggagcgtcaggccttggcctgacaatgcaggagcgc
gaattcctgcgcgcagggcgcccgtggggtttcatcctgttcaagaggaacatcgacaat
cctctgcaggttgcgcgcctggttcaggagtttcgagaagctatcgaggatggtgatgca
cccgtcctgatcgaccaggaaggcggccgcgtgcagcggttggggccgccgcattggccc
gtctatccggcgggcgcgacgttcggcgctctctatgatcgcgatcaggctgcggggttg
gaggccgcgcgacttggcgcgcaactgatcgcggccgatctcgccgatctcggaatcacg
gtcgactgcctgccgctggcggatgttccggtgccgggcgcggatgccgtcatcggtgat
cgcgcttatgggaccgatcccctaaaggtcgcgaccatcgcgcgggccgtcaccgagggg
ctggagcagggtggtgtgttgccggttctcaagcatattccgggtcacggacgggcgacc
gcggacactcatcaccgactcccgatcgtggataccttgaaagacgagcttgaggctgtt
gatttcgctgcgttccgtcccctttctgatctgccgatggcgatgaccgcacatgttgtg
ttcagtgcgattgacgccacccaaccggcgacaacatctgcgacaatcatcgagcaggtg
attcgcggctcgatcggatttcagggactgttgatgagcgatgacgtgtcgatgaatgcg
ctgacgggatcgatcgcccagcggacgagggcgatcgttgcggccgggtgcgacatggtt
ttgcactgcaatggccaattggacgagatgcggcaggtcgccagcgaagctccggaattg
tcgggagtcgcgctggaccgcgcccggcgggccctcgccgcgcgcaggccgccgcaaccg
ttcgaccgcgaagcggcgcgcgcgaaactcgacgcgttgacggcggcaagcgcatga

DBGET integrated database retrieval system