KEGG   Nitrobacter winogradskyi: Nwi_1805Help
Entry
Nwi_1805          CDS       T00276                                 

Definition
glycoside hydrolase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nwi  Nitrobacter winogradskyi
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nwi00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:nwi00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1977594..1978610)
Genome map
AA seq 338 aa AA seqDB search
MSTRAFITGASGLGLTMQEREFLRAGRPWGFILFKRNIDNPLQVARLVQEFREAIEDGDA
PVLIDQEGGRVQRLGPPHWPVYPAGATFGALYDRDQAAGLEAARLGAQLIAADLADLGIT
VDCLPLADVPVPGADAVIGDRAYGTDPLKVATIARAVTEGLEQGGVLPVLKHIPGHGRAT
ADTHHRLPIVDTLKDELEAVDFAAFRPLSDLPMAMTAHVVFSAIDATQPATTSATIIEQV
IRGSIGFQGLLMSDDVSMNALTGSIAQRTRAIVAAGCDMVLHCNGQLDEMRQVASEAPEL
SGVALDRARRALAARRPPQPFDREAARAKLDALTAASA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcgcgcattcatcacgggagcgtcaggccttggcctgacaatgcaggagcgc
gaattcctgcgcgcagggcgcccgtggggtttcatcctgttcaagaggaacatcgacaat
cctctgcaggttgcgcgcctggttcaggagtttcgagaagctatcgaggatggtgatgca
cccgtcctgatcgaccaggaaggcggccgcgtgcagcggttggggccgccgcattggccc
gtctatccggcgggcgcgacgttcggcgctctctatgatcgcgatcaggctgcggggttg
gaggccgcgcgacttggcgcgcaactgatcgcggccgatctcgccgatctcggaatcacg
gtcgactgcctgccgctggcggatgttccggtgccgggcgcggatgccgtcatcggtgat
cgcgcttatgggaccgatcccctaaaggtcgcgaccatcgcgcgggccgtcaccgagggg
ctggagcagggtggtgtgttgccggttctcaagcatattccgggtcacggacgggcgacc
gcggacactcatcaccgactcccgatcgtggataccttgaaagacgagcttgaggctgtt
gatttcgctgcgttccgtcccctttctgatctgccgatggcgatgaccgcacatgttgtg
ttcagtgcgattgacgccacccaaccggcgacaacatctgcgacaatcatcgagcaggtg
attcgcggctcgatcggatttcagggactgttgatgagcgatgacgtgtcgatgaatgcg
ctgacgggatcgatcgcccagcggacgagggcgatcgttgcggccgggtgcgacatggtt
ttgcactgcaatggccaattggacgagatgcggcaggtcgccagcgaagctccggaattg
tcgggagtcgcgctggaccgcgcccggcgggccctcgccgcgcgcaggccgccgcaaccg
ttcgaccgcgaagcggcgcgcgcgaaactcgacgcgttgacggcggcaagcgcatga

DBGET integrated database retrieval system