KEGG   Nitrobacter winogradskyi: Nwi_1835Help
Entry
Nwi_1835          CDS       T00276                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nwi_1835
   01230 Biosynthesis of amino acids
    Nwi_1835
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nwi_1835
   00051 Fructose and mannose metabolism
    Nwi_1835
   00562 Inositol phosphate metabolism
    Nwi_1835
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Nwi_1835
Enzymes [BR:nwi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Nwi_1835
Exosome [BR:nwi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Nwi_1835
  Exosomal proteins of bladder cancer cells
   Nwi_1835
  Exosomal proteins of melanoma cells
   Nwi_1835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2008195..2008947)
Genome map
AA seq 250 aa AA seqDB search
MTGLRPLIAGNWKMNGLKASASELGQIISGAAGPAQKADLLICPPATLVLAFVGAVQGSP
VGIGGQDCHPKPSGAHTGDISAEMLGDAGATAVIVGHSERRADHAESDALVREKAEAAWR
AGLTAIVCVGETQDQRDAGQTLDVVGRQLTGSLPDGATAANLVVAYEPVWAIGTGRTPTS
QDVQEVHRFIREKLAERFSAEGTKIRILYGGSVKPSNAAELLAVPNVNGALIGGASLKAA
DFLGIAQAVA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggctgcgaccgctgattgctggaaactggaagatgaacggcctgaaggcttcg
gccagcgaactcggccagataatttcaggagcggctggtcccgcgcaaaaagccgatctg
ctcatttgtccgccggcgacgctggtgctggcgttcgtgggagcggtgcagggctcgccg
gtgggaattggcgggcaggattgccaccccaagccgtccggagcccacaccggcgatatt
tccgccgagatgctgggggacgcgggcgccaccgcggtcatcgtcggccattccgagcgc
cgcgcagatcatgcggagagcgacgctctggtgcgggagaaggccgaagccgcatggcgg
gcggggctgaccgccatcgtctgcgtcggcgagacgcaggaccagcgcgatgccggtcag
acgctcgatgtggtcggtcggcagctcacgggctcgctgccggatggcgcgacggccgcc
aatctcgtcgtggcctacgaaccggtctgggcgatcggcaccgggcgcacaccgacatcg
caggacgtgcaggaagtccacaggtttatccgcgaaaagctcgcggaacggtttagcgcg
gaaggcacgaagattcgcattctgtacggcgggtcggtgaagccgtcgaacgctgcggag
ttgctcgcggttccgaacgtgaacggagcgttgatcggcggcgccagcctcaaggcggcg
gattttctggggatcgcccaggccgtcgcctga

DBGET integrated database retrieval system