KEGG   Nitrobacter winogradskyi: Nwi_2007Help
Entry
Nwi_2007          CDS       T00276                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nwi00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nwi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2194720..2195808
Genome map
AA seq 362 aa AA seqDB search
MPEQRPDHAGALALVYRDLASAGENPPARCSALPPRTSVPIALALMTSSAKSSFVLGHRH
LLGIEGLSVADITGLLDLSEEYVELNRQVDKKRTSLRGLTQVNLFFEASTRTQSSFEIAG
KRLGADVMNMSVSSLSTRKGETLVDTAMTLNAMHPDILVMRHSASGAVELLARKVDGSVV
NAGDGAHEHPTQALLDALTIRRNKGRLDGLLVAICGDVLHSRVARSNIILLNAMGARVRV
VAPSTLLPPGIERMGVEVARDMREGLDGADIVMMLRLQRERMSGSFVPSSSEYFHYFGLD
QKKLAYAKPNALVMHPGPMNRGVEIDSIVADGTQSLIREQVEMGVAVRMAVLEALARNLP
NA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaacagcggccagatcacgccggcgctctcgccttggtttaccgtgacctcgct
tcggcgggggaaaacccgcctgcgcgctgttcggccttgcccccacggacgagtgtgcct
atagctctggctttaatgacatcgtccgccaaatcgagttttgtcctcggacaccggcat
ctgctgggcatcgagggcctttccgtcgccgatattaccggccttctcgatctttccgaa
gaatacgtcgaactgaaccgccaggtggacaagaaacgcacctccttgcgcggtctcacc
caggtcaacctgttcttcgaggcttcgacccgcacccagtcgtcattcgagatcgccggc
aagcggctcggcgccgacgttatgaatatgtcggtgtcgtcgctatcgacccgcaagggc
gaaacgctggtcgataccgcgatgacgctcaacgccatgcatccggacatccttgtgatg
cgccattcagcctccggcgcggtggaacttctggcgcgcaaggtcgacggctccgtcgtc
aatgccggcgacggcgcccacgaacatccgacccaggcgctgctggacgcattgaccatc
cgccgcaacaagggacggctcgacggacttctggtcgcgatctgcggcgacgttctccac
tcgcgcgtcgcgcgctccaacatcatcctgctcaacgccatgggcgcgcgggtccgcgtc
gtcgcgccgtccacgctgctgccgccgggcatcgagcgcatgggcgtcgaagtcgcccgc
gatatgcgcgagggattggacggcgcggacatcgtgatgatgctgcggctgcagcgcgag
cggatgagcggctcgttcgtgccgtcgagttccgagtacttccactatttcggcctcgac
cagaaaaagctcgcctatgccaaacccaacgcgctggtcatgcatccgggaccgatgaat
cgcggcgtcgagattgactcgatcgtcgcggacggcacgcagtcgctgatccgcgagcag
gtggaaatgggcgtggcggtgcggatggcggtgctggaagcgctggcgaggaacctgccg
aatgcatga

DBGET integrated database retrieval system