KEGG   Nitrobacter winogradskyi: Nwi_2235Help
Entry
Nwi_2235          CDS       T00276                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nwi00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2429897..2430388
Genome map
AA seq 163 aa AA seqDB search
MASVLIALGGNVGDVRQTFRKAIANIRGMAQAALLARSSDYATPPWGEEKQARFVNACIE
IDTGLDPHALLFTLQKIEKKFGRDRAAEQRWGPRTLDLDLIAYDDAILDKPELTLPHPRL
FERAFVLVPLAEIAPDRIIAGQTPARALADISTAGIERLPDLP
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgtcctgatcgcgctcgggggtaacgtcggagacgtcaggcagacgttccgc
aaggccatcgccaacatccgcggcatggcgcaggccgcgctgctcgcccgttcgtccgac
tacgccacgccgccatggggcgaggagaaacaggctcgtttcgtcaacgcctgcatcgag
atcgacaccggcctcgacccgcacgctttgctgttcacgctgcaaaagatcgagaagaaa
ttcggccgcgaccgcgccgccgaacaacgctggggaccgcgcacgctggacctcgacctg
atcgcctatgacgacgccattctcgacaagccggaactgacgctaccgcatccgcgcctg
ttcgagcgcgccttcgttctggttccgcttgccgaaatcgcgccggaccgcattatcgca
gggcaaacaccggccagggcgctggccgacatatcgaccgcaggaatcgagcgcctcccc
gaccttccctga

DBGET integrated database retrieval system