KEGG   Nitrobacter winogradskyi: Nwi_2582Help
Entry
Nwi_2582          CDS       T00276                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nwi_2582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: ABA05835
JGI: Nwi2582
UniProt: Q3SPF6
Position
2807013..2807414
Genome map
AA seq 133 aa AA seqDB search
MKTFAISALTVLGVTLASVGTSSAGDVEAGKSAFNKCKACHEIGEGAKNKVGPELNGLDG
RHSGAVEGYAYSPANKASGITWTEAEFKEYIKDPKAKVPGTKMVFAGIKKDSELDNLWAY
VSQFDKDGKVKAK
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgttcgccatctccgcactgaccgtcctgggcgtcacgctcgcaagcgtgggc
acttcgtccgctggggacgtagaggccggaaaatcagccttcaacaagtgcaaggcatgt
catgaaatcggcgaaggcgccaagaacaaggtcgggccggaactaaacggcctggacgga
cgccactccggcgccgtggaaggctatgcttattcgcccgccaacaaggcttccggcatc
acctggaccgaggccgagttcaaggaatacatcaaggatccgaaggcgaaggtcccgggt
acgaagatggtgttcgccggcatcaagaaggacagcgaactcgacaacctctgggcctat
gtttcgcagttcgacaaggacggcaaagtcaaggcgaagtaa

DBGET integrated database retrieval system