KEGG   Nitrobacter winogradskyi: Nwi_2582Help
Entry
Nwi_2582          CDS       T00276                                 

Definition
(RefSeq) cytochrome c, class I
  KO
K08738  
cytochrome c
Organism
nwi  Nitrobacter winogradskyi
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Nwi_2582
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Nwi_2582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2807013..2807414
Genome map
AA seq 133 aa AA seqDB search
MKTFAISALTVLGVTLASVGTSSAGDVEAGKSAFNKCKACHEIGEGAKNKVGPELNGLDG
RHSGAVEGYAYSPANKASGITWTEAEFKEYIKDPKAKVPGTKMVFAGIKKDSELDNLWAY
VSQFDKDGKVKAK
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgttcgccatctccgcactgaccgtcctgggcgtcacgctcgcaagcgtgggc
acttcgtccgctggggacgtagaggccggaaaatcagccttcaacaagtgcaaggcatgt
catgaaatcggcgaaggcgccaagaacaaggtcgggccggaactaaacggcctggacgga
cgccactccggcgccgtggaaggctatgcttattcgcccgccaacaaggcttccggcatc
acctggaccgaggccgagttcaaggaatacatcaaggatccgaaggcgaaggtcccgggt
acgaagatggtgttcgccggcatcaagaaggacagcgaactcgacaacctctgggcctat
gtttcgcagttcgacaaggacggcaaagtcaaggcgaagtaa

DBGET integrated database retrieval system