KEGG   Nitrobacter winogradskyi: Nwi_2755Help
Entry
Nwi_2755          CDS       T00276                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00072  Synthesis and degradation of ketone bodies
nwi00650  Butanoate metabolism
nwi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Nwi_2755
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Nwi_2755
Enzymes [BR:nwi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Nwi_2755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 Flagellar_rod
Motif
Other DBs
NCBI-ProteinID: ABA06008
JGI: Nwi2755
UniProt: Q3SNY3
Position
complement(2995670..2996458)
Genome map
AA seq 262 aa AA seqDB search
MTKLKGKTAVVTGSTSGIGLAYARAFAGAGANVVINGLGAEADIEKARSGLEAEFEVKAV
YSPADMTKPAEIAGMIELGETTFGSVDILVNNAGIQFVSPVESFPVEKWDAIIAINLSSA
FHAIRAAVPGMKKRGWGRIITTASAHSTVASPFKSAYVAAKHGIAGLTKAVALELAPHRI
TCNCISPGYVWTSLVEKQIPDTMKSRGMTREQVVNDVLLAAQPTKQFVTVEQVAALALYL
CSDDAAQITGSNLSIDGGWTAA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagttgaaaggcaagaccgcggtcgtgaccggatcaaccagcggcataggcctg
gcctatgcccgcgccttcgccggcgccggcgccaatgtcgtgatcaacgggcttggcgcc
gaggctgacatcgagaaggcgcgctccggcctcgaggcggagttcgaggtcaaggcggtc
tactcgcctgccgacatgacgaagcccgccgagatcgccggcatgatcgaactgggcgaa
acaaccttcggctcggtcgatattctcgtcaacaatgccggcatccagttcgtctcgccg
gtcgagtcgttccctgtcgagaagtgggacgcgatcatcgccatcaatctttcatcggct
tttcatgccatccgcgccgcagtgcccggcatgaagaagcgcggctggggccgcatcatc
actaccgcctcggcgcattcgacggtggcatcgcccttcaagtcggcctatgtggccgcc
aagcacggcatagccggcctcaccaaggcggtggcgctcgagcttgcgccgcacaggatc
acctgcaattgcatcagtccgggctatgtctggacctcgctggtggaaaagcagattccc
gacaccatgaagtcgcgcggcatgaccagggagcaggtcgtcaacgatgtgctgctcgcc
gcgcaaccgaccaagcagttcgtcaccgtggagcaggtcgcggcgctggcgctctatctc
tgcagcgacgatgccgcccagatcaccggaagcaacctgtcgatcgatggcggctggacg
gcggcgtaa

DBGET integrated database retrieval system