KEGG   Nitrobacter winogradskyi: Nwi_2765Help
Entry
Nwi_2765          CDS       T00276                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nwi_2765
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Nwi_2765
   00630 Glyoxylate and dicarboxylate metabolism
    Nwi_2765
Enzymes [BR:nwi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Nwi_2765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3006796..3009021
Genome map
AA seq 741 aa AA seqDB search
MNRIDAHGLKIAPVLFDFIAGEATLRTGIKPDAFWAGLAAIVRDLGPRNRELLAVRDRLQ
ARIDDWHRIHKDTPFDISAYTAFLTEIGYLEPEPETRQIETANVDDEIGKICGPQLVVPL
TNARYALNAANARWGSLYDALYGTDAIAREAGEAKGYDKARGDKVIARAKAFLDMATPLA
NGAHADVAGYSVLNGRLSVTLRNGDTTGLKAETQFAGYQGDANAPSAILLVNHGLHIDIQ
IDRAHPIGRHYSAGVADVIIEAAISTILDMEDSVAAVDADDKVLVYRNALGLMNGTLTDT
FEKSGKTLTRALNPDRVYTAPDGGQLTLHGRSLLLIRNVGHHMFTDAVLDQRGAEIPEGL
LDAAISGLLAIHDINGVSKRRNSRSGSLYLVKPKMHGPDEVALTCELFARVEAMLGLREN
TLKIGIMDEERRTTVNLNACIQTASKRVCFINTGFLDRTGDEIHTSMEAGPMIRKGEMKT
QPWIKAYEDWNVDIGLIEGLPGRAQIGKGMWAAPDRMADMLAQKINHPEAGATTAWVPSP
TAATLHALHYHQIDVRKRQQELKAGGRRARLSDLLTIPVSHSNWPPEDVKQEIDNNCQGI
LGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHHGVVTHDQVMDSFKRM
AVIVDEQNAGDPLYKPMAPGFDSVAFKAACDLVFRGREQPNGYTEHILTERRREAKLMAQ
AARAFSGEADTGSPRENATRQ
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaatcgacgcccacggactgaagatcgcgcctgtcctgttcgattttatcgcc
ggggaagccacgctccggaccgggatcaaacccgacgcgttctgggccggacttgcagcg
atcgtgcgcgatctcggaccgagaaaccgcgagctgctcgcggtgcgcgacaggttgcag
gccaggatcgacgactggcatcgcattcataaagacacgccgttcgacatcagcgcctac
acagcgttcctgaccgagatcggctatctggagccggagccggagacgcgacagatcgag
accgccaatgtcgatgacgagatcggcaaaatctgcggcccgcaactggtcgtgccgcta
accaacgcgcgctacgcgttgaacgccgccaacgcgcgctggggcagcctctatgatgcg
ctgtacggcaccgacgccatcgcacgcgaggccggcgaggcgaagggatacgacaaggcg
cgcggcgacaaggtgatcgcgagggcaaaggccttcctcgatatggcaaccccgcttgcg
aacggcgctcatgccgacgtcgcaggctacagcgtgctcaatggacggttgtcggtcacg
ctcaggaacggcgacaccactggtctgaaggcggaaacccagttcgcgggctatcagggt
gatgcgaacgctccatccgcgatcctgctcgtcaatcacggtctgcatatcgacatccag
atcgaccgcgcccaccccatcggcaggcattattccgccggcgtcgccgacgtgatcatc
gaggcggccatcagcaccattctcgacatggaggacagcgtcgccgccgtcgatgccgac
gacaaggtcctggtgtatcgcaatgcgctcggcctgatgaacggcaccctcaccgacact
tttgaaaagagcggcaaaaccctcacccgcgccctcaaccccgaccgcgtctacaccgcg
ccggacggcgggcaactcacgctgcacggacgcagcctgcttttgatccgcaacgtcggt
caccacatgttcaccgacgcggttctcgaccagcgcggcgccgagattcccgagggtctg
ctcgacgcggccatatcgggccttctcgcgattcacgacatcaacggggtttcgaaaagg
cggaatagccgcagcggttcgctctacctggtcaagcccaagatgcacggccccgacgag
gtcgcgctgacctgcgaactgttcgcccgtgtcgaggcgatgctcggactgcgggagaac
acgctcaagatcggcatcatggacgaggaacgccgcaccacggtcaacctcaatgcctgc
atccagaccgcatcgaaacgcgtctgcttcatcaatacaggcttcctcgaccgcaccggc
gacgagattcacacctcgatggaagccggtccgatgatccgcaaaggcgagatgaagacg
cagccatggatcaaggcctatgaggactggaatgtcgacatcggcctgatcgaaggcctg
cccggccgcgcccagatcggcaagggcatgtgggccgcgcccgaccggatggcggacatg
ctggcgcagaaaatcaaccacccggaagcgggcgccaccaccgcatgggtgccgtcgcca
accgcggcgacgctgcacgccttgcactaccaccagatcgacgtgcggaaacgccagcag
gaactgaaggccggcgggcgacgcgccaggctgtccgatcttctcacgatcccggtgtct
cattcgaactggccgcccgaagacgtgaaacaggaaatcgacaacaactgtcagggtatt
ctcggctacgtggtgcgctggatcgatcagggcgtcggctgttcgaaggtgcctgatatc
cacgatgtcggcctgatggaggatcgcgccacgctgcggatttccagccagcatctggcg
aactggctgcatcatggcgtcgttacccacgatcaggtgatggattcgttcaaacgcatg
gctgtcatcgtggatgaacagaacgcgggcgatccgctctacaagccgatggcgccgggc
tttgacagcgtggctttcaaggcggcctgtgatctggtgttcaggggccgggagcaaccg
aacggctataccgaacacatcctgaccgagaggcggcgcgaggccaagcttatggctcag
gcggctcgagcattttccggcgaagcggataccggttcgccgcgggaaaatgcgaccaga
caatag

DBGET integrated database retrieval system