KEGG   Nitrobacter winogradskyi: Nwi_2765Help
Entry
Nwi_2765          CDS       T00276                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nwi_2765
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Nwi_2765
   00630 Glyoxylate and dicarboxylate metabolism
    Nwi_2765
Enzymes [BR:nwi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Nwi_2765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3006796..3009021
Genome map
AA seq 741 aa AA seqDB search
MNRIDAHGLKIAPVLFDFIAGEATLRTGIKPDAFWAGLAAIVRDLGPRNRELLAVRDRLQ
ARIDDWHRIHKDTPFDISAYTAFLTEIGYLEPEPETRQIETANVDDEIGKICGPQLVVPL
TNARYALNAANARWGSLYDALYGTDAIAREAGEAKGYDKARGDKVIARAKAFLDMATPLA
NGAHADVAGYSVLNGRLSVTLRNGDTTGLKAETQFAGYQGDANAPSAILLVNHGLHIDIQ
IDRAHPIGRHYSAGVADVIIEAAISTILDMEDSVAAVDADDKVLVYRNALGLMNGTLTDT
FEKSGKTLTRALNPDRVYTAPDGGQLTLHGRSLLLIRNVGHHMFTDAVLDQRGAEIPEGL
LDAAISGLLAIHDINGVSKRRNSRSGSLYLVKPKMHGPDEVALTCELFARVEAMLGLREN
TLKIGIMDEERRTTVNLNACIQTASKRVCFINTGFLDRTGDEIHTSMEAGPMIRKGEMKT
QPWIKAYEDWNVDIGLIEGLPGRAQIGKGMWAAPDRMADMLAQKINHPEAGATTAWVPSP
TAATLHALHYHQIDVRKRQQELKAGGRRARLSDLLTIPVSHSNWPPEDVKQEIDNNCQGI
LGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHLANWLHHGVVTHDQVMDSFKRM
AVIVDEQNAGDPLYKPMAPGFDSVAFKAACDLVFRGREQPNGYTEHILTERRREAKLMAQ
AARAFSGEADTGSPRENATRQ
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaatcgacgcccacggactgaagatcgcgcctgtcctgttcgattttatcgcc
ggggaagccacgctccggaccgggatcaaacccgacgcgttctgggccggacttgcagcg
atcgtgcgcgatctcggaccgagaaaccgcgagctgctcgcggtgcgcgacaggttgcag
gccaggatcgacgactggcatcgcattcataaagacacgccgttcgacatcagcgcctac
acagcgttcctgaccgagatcggctatctggagccggagccggagacgcgacagatcgag
accgccaatgtcgatgacgagatcggcaaaatctgcggcccgcaactggtcgtgccgcta
accaacgcgcgctacgcgttgaacgccgccaacgcgcgctggggcagcctctatgatgcg
ctgtacggcaccgacgccatcgcacgcgaggccggcgaggcgaagggatacgacaaggcg
cgcggcgacaaggtgatcgcgagggcaaaggccttcctcgatatggcaaccccgcttgcg
aacggcgctcatgccgacgtcgcaggctacagcgtgctcaatggacggttgtcggtcacg
ctcaggaacggcgacaccactggtctgaaggcggaaacccagttcgcgggctatcagggt
gatgcgaacgctccatccgcgatcctgctcgtcaatcacggtctgcatatcgacatccag
atcgaccgcgcccaccccatcggcaggcattattccgccggcgtcgccgacgtgatcatc
gaggcggccatcagcaccattctcgacatggaggacagcgtcgccgccgtcgatgccgac
gacaaggtcctggtgtatcgcaatgcgctcggcctgatgaacggcaccctcaccgacact
tttgaaaagagcggcaaaaccctcacccgcgccctcaaccccgaccgcgtctacaccgcg
ccggacggcgggcaactcacgctgcacggacgcagcctgcttttgatccgcaacgtcggt
caccacatgttcaccgacgcggttctcgaccagcgcggcgccgagattcccgagggtctg
ctcgacgcggccatatcgggccttctcgcgattcacgacatcaacggggtttcgaaaagg
cggaatagccgcagcggttcgctctacctggtcaagcccaagatgcacggccccgacgag
gtcgcgctgacctgcgaactgttcgcccgtgtcgaggcgatgctcggactgcgggagaac
acgctcaagatcggcatcatggacgaggaacgccgcaccacggtcaacctcaatgcctgc
atccagaccgcatcgaaacgcgtctgcttcatcaatacaggcttcctcgaccgcaccggc
gacgagattcacacctcgatggaagccggtccgatgatccgcaaaggcgagatgaagacg
cagccatggatcaaggcctatgaggactggaatgtcgacatcggcctgatcgaaggcctg
cccggccgcgcccagatcggcaagggcatgtgggccgcgcccgaccggatggcggacatg
ctggcgcagaaaatcaaccacccggaagcgggcgccaccaccgcatgggtgccgtcgcca
accgcggcgacgctgcacgccttgcactaccaccagatcgacgtgcggaaacgccagcag
gaactgaaggccggcgggcgacgcgccaggctgtccgatcttctcacgatcccggtgtct
cattcgaactggccgcccgaagacgtgaaacaggaaatcgacaacaactgtcagggtatt
ctcggctacgtggtgcgctggatcgatcagggcgtcggctgttcgaaggtgcctgatatc
cacgatgtcggcctgatggaggatcgcgccacgctgcggatttccagccagcatctggcg
aactggctgcatcatggcgtcgttacccacgatcaggtgatggattcgttcaaacgcatg
gctgtcatcgtggatgaacagaacgcgggcgatccgctctacaagccgatggcgccgggc
tttgacagcgtggctttcaaggcggcctgtgatctggtgttcaggggccgggagcaaccg
aacggctataccgaacacatcctgaccgagaggcggcgcgaggccaagcttatggctcag
gcggctcgagcattttccggcgaagcggataccggttcgccgcgggaaaatgcgaccaga
caatag

DBGET integrated database retrieval system