KEGG   Nitrobacter winogradskyi: Nwi_2799Help
Entry
Nwi_2799          CDS       T00276                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
nwi  Nitrobacter winogradskyi
Pathway
nwi00020  Citrate cycle (TCA cycle)
nwi00190  Oxidative phosphorylation
nwi00650  Butanoate metabolism
nwi01100  Metabolic pathways
nwi01110  Biosynthesis of secondary metabolites
nwi01120  Microbial metabolism in diverse environments
nwi01130  Biosynthesis of antibiotics
nwi01200  Carbon metabolism
Module
nwi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nwi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nwi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nwi_2799
   00650 Butanoate metabolism
    Nwi_2799
  Energy metabolism
   00190 Oxidative phosphorylation
    Nwi_2799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABA06052
JGI: Nwi2799
UniProt: Q3SNT9
Position
3036014..3036421
Genome map
AA seq 135 aa AA seqDB search
MTATPPSGAKSMRTPLGRVRNHGSAHSGTTDFWRQRLTSVAMILLIVPMVVVMMILLGRN
QAGAAQILGSPPIAIIMLLFVVASIWHMKIGMQVIIEDYVHDGKLKLASIMANNFFSVTL
ALTAAYAIFKLSSGV
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaacgccgccatccggcgcgaagtccatgcggaccccgctggggcgggttcgc
aaccatggctcggcccattccggcacgacggatttctggcgccagagactcacctcggtc
gccatgatcctgctcatcgtaccgatggtcgtggtgatgatgatcctgctcggccgcaac
caggcgggcgcggcgcagattctcggctcgccgccgatcgccatcatcatgctgctgttc
gtggtcgccagcatctggcatatgaagatcgggatgcaggtgatcattgaggactacgtg
cacgacggaaagctaaaactggcgtcgatcatggcgaacaactttttctccgtgaccctg
gcgctgaccgccgcttacgccatcttcaaattgtcatccggagtttag

DBGET integrated database retrieval system