KEGG   Nitrobacter winogradskyi: Nwi_2799Help
Entry
Nwi_2799          CDS       T00276                                 

Definition
succinate dehydrogenase, cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nwi  Nitrobacter winogradskyi
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Nwi_2799
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Nwi_2799
   00650 Butanoate metabolism
    Nwi_2799
  Energy metabolism
   00190 Oxidative phosphorylation
    Nwi_2799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3036014..3036421
Genome map
AA seq 135 aa AA seqDB search
MTATPPSGAKSMRTPLGRVRNHGSAHSGTTDFWRQRLTSVAMILLIVPMVVVMMILLGRN
QAGAAQILGSPPIAIIMLLFVVASIWHMKIGMQVIIEDYVHDGKLKLASIMANNFFSVTL
ALTAAYAIFKLSSGV
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaacgccgccatccggcgcgaagtccatgcggaccccgctggggcgggttcgc
aaccatggctcggcccattccggcacgacggatttctggcgccagagactcacctcggtc
gccatgatcctgctcatcgtaccgatggtcgtggtgatgatgatcctgctcggccgcaac
caggcgggcgcggcgcagattctcggctcgccgccgatcgccatcatcatgctgctgttc
gtggtcgccagcatctggcatatgaagatcgggatgcaggtgatcattgaggactacgtg
cacgacggaaagctaaaactggcgtcgatcatggcgaacaactttttctccgtgaccctg
gcgctgaccgccgcttacgccatcttcaaattgtcatccggagtttag

DBGET integrated database retrieval system