KEGG   Nitrobacter winogradskyi: Nwi_2951Help
Entry
Nwi_2951          CDS       T00276                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Nwi_2951
Enzymes [BR:nwi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Nwi_2951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3185229..3186263)
Genome map
AA seq 344 aa AA seqDB search
MEAVQARSRGGTRLLSGDPLFQVSPPAGSVMKLLSIPANPVPENCVSGAVRTSDGVDLRF
ARWPSPQGRKGTVCLFTGRGEQIEKYFETVRDLRDRGFAVAMIDWRGQGHSLRQLPDPRK
GHVRRFSDYENDVRAFVRQVVLPDCPPPYFALAHSMGGAVLLRVARAGNRWFDRMVLSAP
MIDLPGRRTSLPVRTLLRAMRLLGQGGRYVPGGSAQITGMGGFAGNFLTSDPVRFARNVA
ILQEDPTLGIASPTVAWADTAFQTMHDFRDASYPARIRQPLLLIAAGSDAIVSTPAIEQF
AYHLRSGLHLVIAGSKHEILQEQDRYRAQFWAAFDAFVPGTPLF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagttcaggcacgttcaagaggcgggacacggctgctgtcaggcgatccgctc
tttcaggtttctcctccagccggttcggtcatgaagctgctttcaatccccgcaaatccg
gttccggagaattgcgtcagcggcgccgtgagaacctcagacggggtcgacttacgtttc
gcgcggtggccgtcgccgcaggggcgcaaggggaccgtctgcctgttcaccggacgcggc
gagcagatcgaaaagtacttcgagaccgtacgcgatttgcgcgaccgcggttttgcggtg
gcgatgattgactggcggggacaggggcattcgttgcgccagctgcccgacccgcgcaag
ggccatgtgcgccgtttctcagactacgaaaacgacgttcgcgcgttcgtcaggcaggtg
gtgctgccggattgtccgccgccatactttgcgctggcccattcaatggggggagcggtg
ctgctgcgggtggcccgcgccggcaatcgctggttcgaccgcatggtactgtcggcgccg
atgatcgacctgccgggacgtcgcacctcgctcccggtgcgcacgctgctgcgggcgatg
cggctgttgggacagggcggccgctacgttcccggcgggagcgcccagatcaccggcatg
ggcggtttcgccggcaacttcctgaccagcgatcccgtgcggttcgcccgcaatgtcgcg
atcctgcaggaggacccgacgctgggaattgcgtctccgacggtggcatgggccgacacc
gccttccagacgatgcacgattttcgcgatgcaagttatccggcgcggattcgtcagccg
ttgctgttgatcgcggccggcagcgacgccatcgtctccacgccggccatcgagcagttc
gcctatcatctacgcagcggattgcacctcgtcatcgccggatcgaagcatgaaatcctg
caggaacaggatcgctaccgtgcccagttctgggcggcgttcgacgccttcgtgccaggc
acgccgctgttttag

DBGET integrated database retrieval system