KEGG   Nitrobacter winogradskyi: Nwi_2958Help
Entry
Nwi_2958          CDS       T00276                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:nwi00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:nwi00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:nwi00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nwi00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3198386..3199261
Genome map
AA seq 291 aa AA seqDB search
MKIRKAVFPVAGLGTRVLPATKAMPKEMLTIVDRPLIQYVFDEAREAGIEHFIFVTGRNK
SAIEDHFDRQFELDETLKTRGKHAEINLLAQFQPEAGAVSFTRQQAPLGLGHAVWCARDI
VGHEPFAVVLPDELVLNTPGCLKQMMQAAANLGPKSNIVAVEAVPDDMTHNYGICGVGKR
SDRTFEIDGMVEKPPKGTAPSNLSITGRYILQPEIFEILANQERGAGGEIQLTDAMIGLS
KSQAFHGLEFAGERHDCGSRAGFLRANLAFGMARPDLREGLRAEMKKYLGT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccgcaaagccgtctttccggtcgcggggctcggcacccgcgttctccctgcc
accaaggcgatgccgaaggagatgcttacgatcgtcgaccgcccgttgatccagtacgtg
ttcgacgaggccagggaagccggcatagagcacttcattttcgtgaccggccgcaacaag
agcgcaatcgaggatcacttcgaccgccagttcgaactggacgaaacactgaagacgcgc
ggcaagcacgcagagatcaacctgctggcgcaattccagcccgaggccggcgcggtgagt
tttacccggcaacaagcgccgctcgggcttggccacgcggtatggtgcgcccgcgacatc
gtaggccatgagccgttcgcggtggtgttgccggacgaactggtgctgaacacgccgggc
tgcctcaagcagatgatgcaggcggctgcgaatctgggaccgaaatccaacattgtcgcg
gtggaagcggtgcccgatgacatgacccacaactacggcatctgcggtgtgggcaagcgc
agcgaccgcactttcgagatcgacggcatggtggagaagccgccgaaaggcacggccccc
tcgaatctttcgattaccggccgctacattcttcagcccgagatattcgagattctcgca
aaccaggaacgcggcgccggcggcgaaatccagctcaccgacgccatgatcggcctgtcg
aaatcgcaagccttccacggcctcgaattcgccggcgagcgccacgattgcggatcgcgc
gcgggcttcctgcgcgccaatctcgctttcgggatggcgcgtcccgatctacgcgaaggc
ttgcgcgcggagatgaagaagtatctcgggacgtga

DBGET integrated database retrieval system