KEGG   Nitrobacter winogradskyi: Nwi_2958Help
Entry
Nwi_2958          CDS       T00276                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nwi  Nitrobacter winogradskyi
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nwi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Nwi_2958
   00052 Galactose metabolism
    Nwi_2958
   00500 Starch and sucrose metabolism
    Nwi_2958
   00520 Amino sugar and nucleotide sugar metabolism
    Nwi_2958
Enzymes [BR:nwi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Nwi_2958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3198386..3199261
Genome map
AA seq 291 aa AA seqDB search
MKIRKAVFPVAGLGTRVLPATKAMPKEMLTIVDRPLIQYVFDEAREAGIEHFIFVTGRNK
SAIEDHFDRQFELDETLKTRGKHAEINLLAQFQPEAGAVSFTRQQAPLGLGHAVWCARDI
VGHEPFAVVLPDELVLNTPGCLKQMMQAAANLGPKSNIVAVEAVPDDMTHNYGICGVGKR
SDRTFEIDGMVEKPPKGTAPSNLSITGRYILQPEIFEILANQERGAGGEIQLTDAMIGLS
KSQAFHGLEFAGERHDCGSRAGFLRANLAFGMARPDLREGLRAEMKKYLGT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccgcaaagccgtctttccggtcgcggggctcggcacccgcgttctccctgcc
accaaggcgatgccgaaggagatgcttacgatcgtcgaccgcccgttgatccagtacgtg
ttcgacgaggccagggaagccggcatagagcacttcattttcgtgaccggccgcaacaag
agcgcaatcgaggatcacttcgaccgccagttcgaactggacgaaacactgaagacgcgc
ggcaagcacgcagagatcaacctgctggcgcaattccagcccgaggccggcgcggtgagt
tttacccggcaacaagcgccgctcgggcttggccacgcggtatggtgcgcccgcgacatc
gtaggccatgagccgttcgcggtggtgttgccggacgaactggtgctgaacacgccgggc
tgcctcaagcagatgatgcaggcggctgcgaatctgggaccgaaatccaacattgtcgcg
gtggaagcggtgcccgatgacatgacccacaactacggcatctgcggtgtgggcaagcgc
agcgaccgcactttcgagatcgacggcatggtggagaagccgccgaaaggcacggccccc
tcgaatctttcgattaccggccgctacattcttcagcccgagatattcgagattctcgca
aaccaggaacgcggcgccggcggcgaaatccagctcaccgacgccatgatcggcctgtcg
aaatcgcaagccttccacggcctcgaattcgccggcgagcgccacgattgcggatcgcgc
gcgggcttcctgcgcgccaatctcgctttcgggatggcgcgtcccgatctacgcgaaggc
ttgcgcgcggagatgaagaagtatctcgggacgtga

DBGET integrated database retrieval system