KEGG   Phytoplasma (CPA) NZSb11: SLY_0545Help
Entry
SLY_0545          CDS       T02674                                 

Gene name
tdk
Definition
Thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
nzs  Phytoplasma (CPA) NZSb11
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nzs00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(476813..477412)
Genome map
AA seq 199 aa AA seqDB search
MPKEQQGFIEVICGPMFAGKTEALIKRYQEAQKLKKNILSFKPRIDNRYSSEGFIVSHSQ
NKFPAILIDQSRDILPFVTPETDLIIIDEVQFLDNDIFGIVDYLANQNIQIILAGLDLDF
KGKPFGPMPYLLALAEVVTKLTAICAVSGKKATKTQRLINGKPAKSNDSTILVGGQEYHE
PRCRRHHELLDVDKKTINL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagaacaacaaggattcattgaagttatttgtggtcctatgtttgcaggaaaa
acagaagcgttaataaaacgctatcaagaagctcaaaaattgaaaaaaaatattctatca
tttaagcctcgcattgataatcgttattcttctgaaggattcattgtttctcacagtcaa
aataaatttcctgcgattttaattgatcaaagtcgcgatattctcccttttgttactcca
gaaactgacttaataatcattgatgaagttcaatttttagataatgatatttttgggatt
gttgattatttggctaaccaaaatattcaaattattttagcaggtttagatcttgatttt
aaaggcaaacccttcggacctatgccttatttgttagcgttagcagaagttgtgactaag
ttaactgctatttgtgctgttagtggtaaaaaagctactaaaacacaaagattaattaac
ggaaaaccagccaaaagcaatgattcaacaattttagtaggcggtcaagaatatcatgaa
cctcgttgccgccgtcatcatgaattattagacgttgataaaaaaaccattaatttataa

DBGET integrated database retrieval system